Recombinant Campylobacter jejuni Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
corA; CJE0826; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
corA
Target Protein Sequence
MLYIYIKTQNALVQRINFNLDSQELPQNILWIDLLHPSAAEIAFISSEFNLEFPTKEERE EIELSAKYWEDNATITINAHFLVRDLKNDEEDRNLIKLRTEIVTFATAKNILFTIRYNEF STFEEIQARILASPKNFEDGFDIIDKMFEVRVEKDADLLEWIDKEARRLRTSVLEKKDEY SYDEMLKDISSLQELNMRVRDSLFDKRRAMTSLLKSDKIDKDIKQNLTIVLKDLNSLVEF SVSQLNILDNIQTILASQINIEQNKIIKIFTVATVAMMPPTLIGTVYGMNFKFMPELELH YAYPIVLGVMVISIILPLVVFKKKGWL
Uniprot No.

Target Background

Function

CorA, the Campylobacter jejuni magnesium transport protein, mediates the influx of magnesium ions. It also facilitates the uptake of cobalt and manganese. The protein alternates between open and closed conformational states, its activity regulated by cytoplasmic Mg2+ levels; it is activated by low levels and inhibited by high levels.

Database Links

KEGG: cjr:CJE0826

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CorA magnesium transporter in C. jejuni and how was it identified?

The CorA protein (encoded by gene Cj0726C in strain NCTC 11168) represents the primary magnesium transport system in Campylobacter jejuni. This 37-kDa integral membrane protein forms the constitutive Mg²⁺ uptake system in C. jejuni, similar to its homologs in other bacteria and some Archaea. Initial identification occurred through genomic sequence analysis revealing homology to known CorA proteins from Salmonella Typhimurium, where CorA was first cloned in 1985 . Functional characterization of C. jejuni CorA has been performed through mutational analysis and growth experiments with varying magnesium concentrations, confirming its essential role in magnesium acquisition .

What is the essential role of CorA in C. jejuni physiology?

The CorA magnesium transporter plays a crucial and non-redundant role in C. jejuni physiology, as evidenced by several experimental findings. When the corA gene is inactivated by allelic exchange, the resulting mutant strain demonstrates a strict requirement for high magnesium supplementation (20 mM MgCl₂) to achieve growth . This phenotype indicates that:

  • CorA functions as the primary magnesium acquisition system in C. jejuni

  • Magnesium uptake is essential for bacterial growth and survival

  • C. jejuni lacks significant compensatory magnesium transport systems that can function in the absence of CorA

  • The CorA system likely plays a key role in adaptation to environments with limited magnesium availability

Statistical analysis confirms that C. jejuni corA mutants supplemented with 20 mM MgCl₂ show no significant growth difference compared to wild-type strains, but concentrations of 10 mM or less result in approximately 50% reduced growth .

What techniques are most effective for creating and validating C. jejuni corA mutants?

Creating and validating C. jejuni corA mutants requires specific methodological considerations due to the essential nature of this transport system. The following protocol represents an optimized approach:

  • Mutant Generation by Allelic Exchange:

    • Design primers to amplify regions flanking the corA gene (Cj0726C)

    • Insert an antibiotic resistance cassette (typically kanamycin) between these regions

    • Introduce the construct into C. jejuni by electroporation

    • Critical step: Supplement selection media with 20 mM MgCl₂ to enable survival of corA mutants

  • Validation Methods:

    • PCR confirmation of correct insertion and disruption of the corA gene

    • Genomic sequencing to verify the exact location and nature of the mutation

    • Phenotypic validation through growth experiments with and without magnesium supplementation

    • Complementation studies to restore wild-type phenotype

  • Phenotypic Characterization:

    • Qualitative plate assays comparing growth with and without Mg²⁺ supplementation

    • Quantitative growth curve analysis with varying MgCl₂ concentrations

    • Specificity testing using other cations (CaCl₂, NaCl) to confirm Mg²⁺-specific phenotype

How can recombinant C. jejuni CorA protein be expressed and purified for structural and functional studies?

Expression and purification of recombinant C. jejuni CorA presents several technical challenges due to its nature as an integral membrane protein. A systematic approach includes:

  • Expression System Selection:

    • E. coli expression systems (BL21(DE3), C41/C43 for membrane proteins)

    • Consider functional complementation in E. coli ΔrecBCD systems as a validation approach

    • Cell-free expression systems for difficult membrane proteins

  • Construct Design:

    • Full-length construct with appropriate affinity tag (His₆, FLAG, etc.)

    • Truncated constructs removing membrane-spanning regions for soluble domain studies

    • Fusion proteins (MBP, SUMO, etc.) to enhance solubility

  • Expression Optimization:

    • Temperature reduction (16-20°C) during induction

    • Lower inducer concentrations (0.1-0.5 mM IPTG)

    • Extended expression times (16-24 hours)

    • Inclusion of magnesium (10-20 mM) in growth media

  • Purification Strategy:

    • Membrane isolation through ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO, etc.)

    • Affinity chromatography followed by size exclusion

    • Magnesium supplementation (5-10 mM) in all buffers to maintain stability

  • Functional Validation:

    • Transport assays using liposome reconstitution

    • Isothermal titration calorimetry for binding studies

    • Circular dichroism for secondary structure confirmation

How does C. jejuni CorA compare functionally with homologous transporters in other bacterial species?

The CorA magnesium transporter in C. jejuni shares functional similarities with homologs in other bacteria, but also exhibits species-specific characteristics:

Bacterial SpeciesCorA CharacteristicsMagnesium Transport PropertiesAlternative Mg²⁺ Systems
C. jejuniEssential for growth; requires 20 mM Mg²⁺ supplementation when inactivatedPrimary constitutive Mg²⁺ uptake system; may function in low-Mg²⁺ environmentsNo significant compensatory systems identified
S. TyphimuriumRequired for full virulence in mouse modelsMediates influx of Mg²⁺, Co²⁺, and Ni²⁺Multiple additional Mg²⁺ transport systems present
E. coliWell-characterized structure and functionMediates influx of Mg²⁺, Co²⁺, and Ni²⁺MgtA and MgtB systems provide redundancy
H. pyloriExtensively studiedSimilar ion specificity to S. TyphimuriumLimited redundancy in transport systems

The C. jejuni CorA appears to be more essential for bacterial survival compared to some other species, as evidenced by the inability of corA mutants to grow without high magnesium supplementation . This suggests that C. jejuni has fewer redundant magnesium transport systems compared to bacteria like S. Typhimurium, where other systems can partially compensate for CorA function . In terms of ion specificity, the C. jejuni CorA likely mediates transport of Mg²⁺ as its primary substrate, with possible transport of Co²⁺ and Ni²⁺ as seen in other bacterial homologs, though this specificity requires further investigation .

What role might CorA play in C. jejuni virulence and host colonization?

The CorA magnesium transporter likely contributes significantly to C. jejuni pathogenesis through several mechanisms:

  • Essential Nutrient Acquisition:

    • The gastrointestinal environment represents a magnesium-limited niche where efficient transport systems are crucial

    • CorA appears to be the primary magnesium acquisition system, making it essential for in vivo survival

    • The mutant's inability to grow without high magnesium supplementation suggests CorA is required for adaptation to low-magnesium environments such as the gut

  • Potential Connection to Flagellar Motility:

    • Flagellar motility is essential for C. jejuni colonization and invasion of epithelial cells

    • Laboratory evolution experiments show that C. jejuni can rapidly lose motility when selective pressure is removed

    • Mg²⁺ is required for proper flagellar function, suggesting CorA-mediated magnesium transport may influence motility

  • Stress Response and Adaptation:

    • C. jejuni encounters numerous stressors in the host environment, including bile

    • Proper DNA repair mechanisms are crucial for C. jejuni survival during host colonization

    • Magnesium plays important roles in enzyme function and cellular processes that contribute to stress resistance

The hypothesis that CorA is required for full virulence is supported by analogous findings in S. Typhimurium, where CorA is required for full virulence in mouse models despite the presence of additional magnesium transport systems .

What experimental challenges arise when studying CorA function in C. jejuni, and how can they be addressed?

Investigating CorA function in C. jejuni presents several technical challenges that require specific methodological approaches:

  • Essential Nature of the Gene:

    • Challenge: Direct knockout results in non-viable bacteria without supplementation

    • Solution: Always include 20 mM MgCl₂ in media when generating or maintaining corA mutants

    • Alternative: Consider conditional expression systems or partial function mutations

  • Membrane Protein Expression:

    • Challenge: Membrane proteins often express poorly or form inclusion bodies

    • Solution: Optimize expression conditions (temperature, induction, etc.)

    • Alternative: Consider fusion partners or expression of soluble domains

  • Functional Assays:

    • Challenge: Direct measurement of magnesium transport is technically difficult

    • Solution: Use growth phenotypes under varying magnesium conditions as a proxy

    • Alternative: Implement radioisotope (²⁸Mg) transport assays or fluorescent magnesium indicators

  • Genetic Manipulation in C. jejuni:

    • Challenge: C. jejuni is naturally transformable but at low efficiency

    • Solution: Optimize electroporation conditions and use highly concentrated DNA

    • Alternative: Consider complementation in heterologous systems like E. coli for functional studies

How can researchers distinguish between direct and indirect effects of CorA mutation in experimental studies?

Distinguishing between primary effects directly caused by CorA dysfunction and secondary effects resulting from magnesium limitation requires careful experimental design:

  • Complementation Studies:

    • Reintroduce wild-type corA gene to mutant strains

    • Include controls with point mutations in key functional residues

    • Verify restoration of magnesium transport function

  • Magnesium Supplementation Experiments:

    • Test multiple magnesium concentrations (5 mM, 10 mM, 20 mM)

    • Include time-course analysis to identify immediate versus delayed effects

    • Test other divalent cations (Ca²⁺, Ni²⁺) to confirm specificity

  • Global Analysis Approaches:

    • Transcriptomics to identify gene expression changes

    • Proteomics to detect protein abundance alterations

    • Metabolomics to assess metabolic pathway disruptions

  • Separation of Growth and Function:

    • Use conditions where growth is supported (with Mg²⁺ supplementation)

    • Test specific functions (motility, adherence, invasion) under these permissive conditions

    • This approach separates growth defects from specific functional impairments

What are promising approaches for studying the structural biology of C. jejuni CorA?

Structural characterization of C. jejuni CorA presents opportunities to understand its specific mechanisms and unique features compared to homologs in other bacteria:

  • X-ray Crystallography Approaches:

    • Detergent screening for optimal solubilization

    • Lipidic cubic phase crystallization for membrane proteins

    • Surface entropy reduction mutations to enhance crystallization propensity

  • Cryo-Electron Microscopy:

    • Single-particle analysis of purified CorA

    • Reconstitution into nanodiscs to maintain native lipid environment

    • Local resolution enhancement techniques for transmembrane regions

  • Integrative Structural Biology:

    • Homology modeling based on existing bacterial CorA structures

    • Validation using biochemical approaches (cysteine crosslinking, etc.)

    • Molecular dynamics simulations to understand ion permeation

  • Structure-Function Analysis:

    • Site-directed mutagenesis of predicted functional residues

    • Functional complementation assays to validate structural predictions

    • Ion selectivity studies to define the transport mechanism

How might understanding CorA function contribute to developing new antimicrobial strategies against C. jejuni?

The essential nature of the CorA magnesium transporter in C. jejuni presents opportunities for targeting this system in antimicrobial development:

  • CorA as a Direct Target:

    • The essentiality of CorA for C. jejuni growth makes it an attractive target

    • Small molecule inhibitors could potentially block magnesium transport

    • Differences between bacterial and eukaryotic magnesium transporters could enable selectivity

  • Exploitation of Magnesium Dependency:

    • Magnesium chelation strategies in combination with other antimicrobials

    • Compounds that compete for magnesium binding sites within CorA

    • Drugs that interfere with magnesium-dependent processes downstream of transport

  • Vaccine Development Approaches:

    • Surface-exposed epitopes of CorA as potential vaccine antigens

    • Attenuated C. jejuni strains with modified CorA function as live vaccines

    • Understanding the role of CorA in host immune recognition

  • Combination Therapies:

    • Synergistic approaches targeting magnesium transport and utilization

    • Strategies to disrupt multiple essential metal acquisition systems

    • Host-directed therapies that limit magnesium availability during infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.