Recombinant Campylobacter jejuni Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Role

Lgt is a membrane-associated enzyme that catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins. This modification is the first step in bacterial lipoprotein maturation, anchoring proteins to membranes and enabling downstream processing . In C. jejuni, Lgt is encoded by the lgt gene (locus CJE0456 in strain RM1221) , and its activity is essential for bacterial viability .

Key Residues and Domains

Residue/RegionRole
Transmembrane domains (7)Membrane integration and substrate binding
Lgt signature motifContains invariant residues (Y26, N146, G154) critical for catalysis
Phosphatidylglycerol-binding siteBinds lipid substrate for diacylglyceryl transfer

Mutations in residues Y26, N146, or G154 abolish enzymatic activity, as shown by complementation assays in E. coli .

Functional Insights from Genetic Studies

  • Essentiality: Depletion of Lgt disrupts outer membrane integrity, increasing bacterial susceptibility to serum killing and antibiotics .

  • Evolutionary Conservation: Despite high recombination rates in C. jejuni, lgt remains conserved, suggesting strong purifying selection .

  • Interspecies Horizontal Gene Transfer (HGT): C. jejuni and C. coli share lgt homologs, indicating gene flow between these species .

Available Recombinant Lgt Products

Product (Source)Expression SystemApplications
CSB-CF692173CAAA E. coliELISA, immunogen production
VAng-Ly2206 E. coli, yeast, or mammalian cellsVaccine development, structural studies

Therapeutic Targeting

  • Inhibitors: Novel compounds (e.g., G2823, IC₅₀ = 0.93 μM) inhibit Lgt activity, showing bactericidal effects against E. coli and Acinetobacter baumannii .

  • Vaccines: Recombinant Lgt is used as an antigen to develop vaccines against C. jejuni-induced gastroenteritis .

Research Findings

  • Mechanistic Studies: Lgt’s enzymatic activity has been reconstituted in vitro using fluorescent substrates (e.g., lipoGFP), confirming its diacylglyceryl transfer function .

  • Genetic Complementation: C. jejuni Lgt can rescue E. coli lgt mutants, highlighting functional conservation across species .

  • Antibiotic Synergy: Lgt inhibition sensitizes bacteria to β-lactams and colistin, suggesting combinatorial therapeutic strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
lgt; CJE0456; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
lgt
Target Protein Sequence
MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVRKFQLDINEKHLDSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKANPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGVLRH PSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI
Uniprot No.

Target Background

Function

Function: Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.

Database Links

KEGG: cjr:CJE0456

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of prolipoprotein diacylglyceryl transferase (Lgt) in C. jejuni?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme in the lipid modification pathway of bacterial lipoproteins. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol (PG) to the conserved cysteine residue in the lipobox motif of preprolipoproteins. This post-translational modification is essential for proper anchoring of lipoproteins to the bacterial membrane. In C. jejuni, this process is particularly important as the organism produces an array of glycoproteins that play significant roles in pathogenesis and host-cell interaction mechanisms .

How does C. jejuni Lgt differ structurally from Lgt enzymes in other bacterial species?

While the core catalytic mechanism of Lgt is conserved across bacterial species, C. jejuni Lgt exhibits unique structural features that likely reflect adaptation to the specific membrane composition and environmental conditions this pathogen encounters. The crystal structure analysis of E. coli Lgt (which shares homology with C. jejuni Lgt) reveals a multi-transmembrane domain protein with specific binding sites for phosphatidylglycerol substrate and the preprolipoprotein. The catalytic site contains a conserved histidine residue (His103) that functions as a catalytic base in the diglyceride transfer reaction, abstracting a proton from the conserved cysteine residue of the preprolipoprotein . Specific structural differences in C. jejuni Lgt may include variations in transmembrane domains and surface-exposed regions that interact with the unique glycolipid composition of the C. jejuni membrane.

What is the relationship between Lgt activity and C. jejuni pathogenesis?

Lgt activity directly affects C. jejuni pathogenesis by enabling proper membrane localization of multiple virulence-associated lipoproteins. Lipoproteins modified by Lgt include adhesins and immune modulators that mediate host-cell interactions. The lipid modification machinery in C. jejuni appears to be particularly significant for pathogenesis as both N-linked glycoproteins and distinct lipooligosaccharide glycoforms serve as ligands for human C-type lectin receptors such as Macrophage Galactose-type Lectin (MGL) . These interactions influence bacterial adhesion to host cells and modulate immune responses. For instance, research has shown that C. jejuni lacking N-linked glycans enhances interleukin-6 production by human dendritic cells compared to wild-type bacteria, suggesting that glycosylated lipoproteins may play a role in immune evasion .

What is the catalytic mechanism of C. jejuni Lgt at the molecular level?

The catalytic mechanism of C. jejuni Lgt involves several precisely coordinated steps. Based on structural and biochemical studies, His103 functions as a catalytic base that abstracts a proton from the conserved cysteine residue in the preprolipoprotein, thereby activating it for nucleophilic attack on the sn-1 position of phosphatidylglycerol (PG) . For this reaction to proceed efficiently, the C3-O ester bond of PG must be activated. Key residues in the active site, including Arg143, form essential hydrogen bonds and electrostatic interactions with the substrate. Specifically, Arg143 interacts with the phosphate O3 of the PG molecule and forms ionic interactions with Glu206 . The presence of the glycerol head group in PG is crucial for proper orientation of catalytically important residues like Arg143 and Arg239, which organize the active site for diacylglycerol transfer. This sophisticated mechanism ensures the specific and efficient transfer of the diacylglyceryl moiety to the appropriate target proteins.

How do mutations in key catalytic residues of Lgt affect lipoprotein processing in C. jejuni?

Mutations in key catalytic residues of Lgt significantly disrupt lipoprotein processing in C. jejuni, with substantial downstream effects on bacterial physiology and pathogenesis. Molecular studies have shown that alterations in the conserved histidine residue (His103) that functions as the catalytic base severely impair the enzyme's ability to transfer the diacylglyceryl moiety from phosphatidylglycerol to target preprolipoproteins . Similarly, mutations in residues like Arg143, which forms critical electrostatic interactions with the phosphate group of phosphatidylglycerol, can dramatically reduce catalytic efficiency. These mutations lead to the accumulation of unprocessed preprolipoproteins and disrupt the proper localization of multiple virulence-associated proteins to the bacterial membrane, potentially altering bacterial surface architecture, adhesion capabilities, and immune recognition patterns.

What is the interplay between Lgt and other enzymes in the lipoprotein maturation pathway in C. jejuni?

The lipoprotein maturation pathway in C. jejuni involves a coordinated sequence of enzymatic modifications. After Lgt catalyzes the addition of a diacylglyceryl moiety to the preprolipoprotein, the signal peptide is cleaved by lipoprotein signal peptidase II (Lsp), and the N-terminal cysteine may be further modified by apolipoprotein N-acyl transferase (Lnt) . Research has shown that the X-ray crystal structures of both Lgt and Lnt have been determined, providing insights into how these enzymes function in concert. The proper functioning of this pathway is essential for producing mature lipoproteins that can correctly locate to the bacterial membrane. Disruptions in any step of this pathway can have cascading effects on lipoprotein processing and bacterial physiology. The interplay between these enzymes represents a potential target for developing novel antimicrobial therapies, as suggested by studies focused on post-translational modification mechanisms in bacterial pathogens .

What are the optimal conditions for expressing recombinant C. jejuni Lgt in E. coli expression systems?

For optimal expression of recombinant C. jejuni Lgt in E. coli systems, several parameters need careful optimization. The enzyme's hydrophobic nature as a multi-pass transmembrane protein presents significant expression challenges. Researchers should consider using specialized E. coli strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression. Expression vectors containing a mild promoter (such as pBAD or tightly regulated T7) help prevent toxicity from overexpression. For induction, lower IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-25°C) during extended induction periods (16-24 hours) generally yield better results than standard conditions. Additionally, supplementing the growth medium with glycerol (0.5-1%) can help stabilize membrane proteins during expression. For extraction and purification, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are recommended to solubilize the protein while maintaining its native conformation and activity .

How can researchers verify the proper folding and activity of recombinant C. jejuni Lgt?

Verifying the proper folding and activity of recombinant C. jejuni Lgt requires a multi-faceted approach. First, circular dichroism (CD) spectroscopy can assess secondary structure content, which is particularly useful for confirming the presence of alpha-helical regions characteristic of transmembrane domains. Second, thermal shift assays can evaluate protein stability and provide insights into proper folding. Third, size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) helps determine whether the protein exists in the proper oligomeric state. Most critically, enzymatic activity should be assessed using an in vitro assay that measures the transfer of a diacylglyceryl moiety from phosphatidylglycerol to a synthetic peptide containing the lipobox motif. This can be monitored by mass spectrometry or radioactive labeling approaches. A complementary approach would be to perform functional complementation studies, where the recombinant protein is expressed in an Lgt-deficient bacterial strain to determine if it can restore lipoprotein processing .

What are the most effective purification strategies for obtaining high-yield, active recombinant C. jejuni Lgt?

Purifying active recombinant C. jejuni Lgt at high yield requires specialized strategies due to its membrane-embedded nature. The most effective approach typically involves a staged purification protocol. Initially, bacterial membranes should be isolated through differential centrifugation following cell lysis. The membrane fraction is then solubilized using carefully selected detergents—DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) are particularly effective for maintaining Lgt activity. For affinity purification, a C-terminal His6 or His10 tag is preferable to N-terminal tags, which may interfere with proper membrane insertion. Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed with detergent-containing buffers. Subsequently, size exclusion chromatography serves as a critical polishing step to remove aggregates and obtain monodisperse protein. Throughout purification, phospholipids (particularly phosphatidylglycerol) should be supplemented at low concentrations (0.01-0.05%) to stabilize the enzyme. For long-term storage, the purified enzyme should be maintained in a buffer containing a stabilizing detergent and 20-30% glycerol at -80°C to preserve activity .

How can recombinant C. jejuni Lgt be utilized for structural biology studies?

Recombinant C. jejuni Lgt presents valuable opportunities for structural biology investigations using multiple complementary techniques. For X-ray crystallography, the purified protein can be reconstituted into lipidic cubic phases (LCP) or stabilized in detergent micelles for crystallization trials. Successful crystallization conditions often include PEG 400 as a precipitant and specific lipids that mimic the native membrane environment. For cryo-electron microscopy (cryo-EM), the protein can be incorporated into nanodiscs using MSP1D1 scaffold proteins and a mixture of POPC/POPG lipids to mimic the bacterial membrane, allowing visualization of the protein in a near-native environment. Nuclear magnetic resonance (NMR) studies, particularly solid-state NMR, can provide atomic-level insights into protein dynamics during catalysis when the enzyme is reconstituted into liposomes. For computational approaches, molecular dynamics simulations can model the interaction between Lgt, its phosphatidylglycerol substrate, and preprolipoprotein acceptors, providing insights into transition states and energy landscapes during catalysis. These structural investigations are crucial for understanding the mechanism of His103 as a catalytic base and how Arg143 interacts with the phosphate O3 of the PG molecule .

What are the challenges in designing specific inhibitors targeting C. jejuni Lgt?

Designing specific inhibitors for C. jejuni Lgt presents several significant challenges. First, the membrane-embedded nature of Lgt complicates both computational and experimental screening approaches. Second, achieving selectivity between bacterial Lgt and host enzymes requires detailed understanding of structural differences in the catalytic site. Third, any potential inhibitor must possess suitable physicochemical properties to penetrate the bacterial outer membrane while reaching the membrane-embedded active site. Fourth, differences between Lgt enzymes from various bacterial species may limit the development of broad-spectrum inhibitors. Rational design approaches could focus on compounds that mimic the transition state of the reaction, particularly analogues of phosphatidylglycerol with modifications at the sn-1 position that would compete with the natural substrate. Alternative strategies include developing peptidomimetics that resemble the lipobox motif but contain non-cleavable linkages or identifying allosteric inhibitors that bind to regions important for enzyme conformational changes during catalysis. Biochemical assays to evaluate potential inhibitors could utilize purified Lgt reconstituted in liposomes or nanodiscs, with activity measured through mass spectrometry-based detection of lipidated peptide products .

How can heterologous expression of C. jejuni Lgt be exploited for vaccine development?

Heterologous expression of C. jejuni Lgt offers innovative approaches for vaccine development through several mechanisms. First, recombinant Lgt can be utilized to generate lipidated antigens with enhanced immunogenicity. By co-expressing C. jejuni Lgt with candidate vaccine antigens containing an appropriate lipobox motif in bacterial expression systems, researchers can produce self-adjuvanting vaccine components where the lipid moiety activates Toll-like receptor 2 (TLR2), enhancing innate immune responses. Second, the C. jejuni N-glycosylation machinery (pgl locus) can be co-expressed with Lgt in recombinant systems to produce glycosylated lipoproteins that mimic native C. jejuni surface antigens, potentially generating more effective immune responses against epitopes present in the pathogen. Third, recombinant bacterial vectors expressing C. jejuni Lgt can be engineered to target specific immune cell populations through interactions with receptors like the Macrophage Galactose-type lectin (MGL) . These approaches exploit the finding that both N-linked glycoproteins and distinct lipooligosaccharide glycoforms of C. jejuni can interact with human C-type lectin MGL, and that this interaction can be transferred to recombinant bacteria when expressing the C. jejuni glycosylation machinery .

What is the relationship between Lgt-mediated lipidation and protein glycosylation in C. jejuni?

The relationship between Lgt-mediated lipidation and protein glycosylation in C. jejuni represents a fascinating intersection of two post-translational modification systems. C. jejuni was the first bacterium identified with N-linked protein glycosylation machinery, and it displays a range of glycosylated structures including both N- and O-linked glycoproteins . Research has demonstrated that proteins modified by the N-linked glycosylation machinery encoded by the pgl locus can bind to human Macrophage Galactose-type lectin (MGL) . Many of these glycosylated proteins are also lipoproteins that require Lgt-mediated lipidation for proper membrane anchoring. The two modification systems appear to work in concert to generate surface-exposed molecules with defined spatial orientations and host-interaction capabilities. The temporal sequence of these modifications remains an area of active investigation, but the presence of both lipid and glycan moieties significantly impacts protein localization and function. This dual modification system may provide C. jejuni with unique capabilities for adhesion, immune evasion, and environmental adaptation that contribute to its success as a pathogen .

How do lipooligosaccharide modifications intersect with Lgt function in C. jejuni?

The intersection between lipooligosaccharide (LOS) modifications and Lgt function in C. jejuni reveals complex relationships between different surface glycoconjugates. Research has shown that C. jejuni lipooligosaccharide with a terminal N-acetylgalactosamine (GalNAc) residue is recognized by the human Macrophage Galactose-type lectin (MGL), similar to N-linked glycoproteins modified by the pgl locus . The lgtF gene in C. jejuni encodes a two-domain glucosyltransferase responsible for transferring glucose residues to the LOS core, and mutation of this gene results in truncated LOS structures . While Lgt primarily functions in the lipidation of preprolipoproteins, the lipidated proteins it produces may interact with LOS in the membrane, potentially influencing outer membrane architecture and stability. Some lipoproteins processed by Lgt may also participate in LOS biosynthesis or modification pathways. For instance, mutation studies of LOS biosynthesis genes like lgtF and galT demonstrate their importance in maintaining proper LOS structure, which in turn affects bacterial virulence without necessarily altering the ability of C. jejuni to invade intestinal epithelial cells in vitro . This suggests complex interplay between different surface components processed by distinct but potentially interconnected enzymatic pathways.

What are the most promising approaches for using recombinant C. jejuni Lgt in synthetic biology applications?

Recombinant C. jejuni Lgt offers several promising avenues for synthetic biology applications. First, the enzyme can be employed in the creation of self-assembling bacterial membrane mimics for drug delivery systems. By co-expressing Lgt with designer lipoproteins containing functional domains (such as targeting peptides or enzymes) in bacterial or cell-free expression systems, researchers can generate functionalized proteoliposomes with precisely controlled surface properties. Second, recombinant Lgt can be utilized in the development of bacterial surface display technologies. The C. jejuni N-glycosylation machinery can be exploited together with Lgt to create recombinant bacteria displaying both lipidated and glycosylated proteins, potentially targeting them to specific host receptors like MGL . Third, Lgt can serve as a tool for selective protein labeling in complex biological samples. By engineering recognition sequences into proteins of interest and using Lgt to transfer modified lipids containing bioorthogonal handles, researchers can achieve site-specific protein labeling for visualization or pulldown experiments. Fourth, the enzyme could be employed in the development of bacterial biosensors where Lgt-mediated lipidation serves as a membrane-anchoring mechanism for sensing components, ensuring proper orientation and proximity to transmembrane signaling domains.

How might high-throughput screening approaches be optimized to identify novel Lgt inhibitors?

Optimizing high-throughput screening for novel Lgt inhibitors requires specialized approaches due to the enzyme's membrane-associated nature. A comprehensive screening strategy should incorporate multiple complementary methods. First, researchers should develop a fluorescence-based assay where the transfer of a diacylglyceryl moiety from fluorescently labeled phosphatidylglycerol to a peptide substrate results in measurable changes in fluorescence polarization or FRET signals. Second, thermal shift assays can identify compounds that specifically bind to Lgt and alter its thermal stability. Third, competitive binding assays using phosphatidylglycerol analogs with reporter groups can detect compounds that compete for the substrate binding site. For cell-based screens, researchers could develop bacterial reporter strains where Lgt inhibition leads to altered localization of a fluorescent lipoprotein fusion. To ensure physiological relevance, a counter-screen against mammalian cell lines can identify compounds with selective toxicity toward bacteria. Computational approaches, including molecular docking against the crystal structure with focus on the His103 catalytic site and the Arg143 interaction site, can pre-screen virtual libraries . Machine learning algorithms trained on known inhibitors of related enzymes might further enhance hit identification. Successful compounds should be validated using biochemical assays with purified recombinant C. jejuni Lgt reconstituted in appropriate membrane mimics.

What are the implications of C. jejuni glycobiology for developing novel antimicrobial strategies targeting Lgt?

The unique glycobiology of C. jejuni presents distinctive opportunities for developing antimicrobial strategies targeting Lgt. First, the interconnection between lipidation and glycosylation pathways suggests that dual-targeting approaches could yield synergistic effects. Compounds that simultaneously inhibit Lgt and key glycosylation enzymes might disrupt multiple surface structures required for pathogenesis. Second, the finding that C. jejuni N-linked glycoproteins and lipooligosaccharide glycoforms bind to human receptors like MGL suggests that inhibitors mimicking these interactions could block critical host-pathogen interfaces . Third, since C. jejuni was the first bacterium identified with N-linked protein glycosylation machinery , and this machinery produces a highly conserved glycan structure between strains, strategies targeting the interface between lipidation and glycosylation might be particularly effective against this pathogen. Fourth, understanding how Lgt processes potentially glycosylated substrate proteins could reveal unique structural features to exploit for selective inhibitor design. Development of such inhibitors would benefit from the detailed structural information available about the catalytic mechanism of Lgt, including the role of His103 as a catalytic base and the interactions of Arg143 with phosphatidylglycerol . Therapeutic approaches targeting these pathways could potentially disrupt C. jejuni's ability to adhere to host tissues or modulate immune responses, offering new strategies against this leading cause of bacterial enterocolitis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.