Recombinant Campylobacter jejuni Putative protein-disulfide oxidoreductase (CJE0952)

Shipped with Ice Packs
In Stock

Description

Contextual Role in the C. jejuni Dsb System

The C. jejuni Dsb system is a complex network of thiol oxidoreductases responsible for maintaining redox homeostasis and protein stability. Key enzymes include:

EnzymeFunctionKey Findings
DsbA1Primary oxidaseEssential for motility, autoagglutination, and CjPhoX activity
DsbA2Substrate-specific oxidaseRequired for CjAstA activity; lacks impact on motility
C8J_1298Bifunctional oxidoreductaseActs as a DsbG homolog; compensates for DsbA1 in knockout strains

While CJE0952 is not explicitly mentioned in these studies, its classification as a Dsb enzyme implies potential redundancy or niche-specific activity within this system. Notably, DsbA1 and C8J_1298 exhibit functional overlap, suggesting that CJE0952 might interact with similar substrates or redox partners .

Functional Specificity

Unlike DsbA1 and DsbA2, which have defined substrate profiles, CJE0952’s targets remain uncharacterized. Its putative role as an oxidoreductase could extend to:

  • Protein Maturation: Facilitating disulfide bond formation in surface-exposed proteins critical for colonization.

  • Redox Regulation: Modulating cysteine sulfenylation in response to oxidative stress .

Experimental Challenges

  • Lack of Direct Validation: No studies confirm CJE0952’s enzymatic activity or physiological relevance in C. jejuni.

  • Genetic Redundancy: Overlap with DsbA1 and C8J_1298 may mask its specific contributions in knockout models .

C8J_1298 (CjDsbC)

This bifunctional enzyme shares structural and functional similarities with Helicobacter pylori HP0231. Key features include:

  • Dual Activity: Acts as both an oxidase and isomerase depending on genetic context .

  • Interaction Partners: Redox partner CjDsbD (C8J_0565) facilitates electron transfer .

DsbA1 vs. DsbA2

FeatureDsbA1DsbA2
SubstratesCjPhoX, flagellin, motility proteinsCjAstA
Phenotype ImpactEssential for motility/autoagglutinationNo motility defect observed
Genetic ContextActs independently of DsbBRequires DsbB for activity

These distinctions highlight the compartmentalized roles of Dsb enzymes in C. jejuni, underscoring the need to map CJE0952’s niche .

Implications for Vaccine and Therapeutic Development

While CJE0952 is not a direct vaccine target, insights into the C. jejuni Dsb system inform strategies to disrupt pathogen viability. For example:

  • DsbA1 Inhibition: Targeting this enzyme could impair motility and colonization, as shown in flagellin-deficient mutants .

  • Redox-Dependent Therapies: Exploiting oxidative stress vulnerabilities via Dsb system inhibitors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbI; CJE0952; Putative protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
dsbI
Target Protein Sequence
MSYIKMKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRF DMLVMAIGGMIALINPANNIIKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVD GCREIPIYPFNLPLYKWAPSWFLPTGECGMDTPVVPENAYNHLNAFQKFFIGTPPDFENG LYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVL VLKFIGESKNPNQNIASLNQVVLRYS
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in some proteins. This protein is part of a redox system composed of DsbI and DsbL that mediates the formation of an essential disulfide bond in AssT.
Database Links

KEGG: cjr:CJE0952

Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of protein-disulfide oxidoreductases in C. jejuni?

Protein-disulfide oxidoreductases in C. jejuni, particularly those in the Dsb family, are involved in the oxidative folding of many proteins through the formation of disulfide bonds between cysteine residues. These enzymes play critical roles in ensuring proper protein folding in the bacterial periplasm. C. jejuni contains two primary DsbA oxidoreductases (CjDsbA1 and CjDsbA2), which are functional homologs of DsbL, with CjDsbA1 serving as the primary thiol-oxidoreductase affecting processes associated with bacterial spread and host colonization . Proper functioning of these oxidoreductases is essential for numerous cellular processes, including motility, autoagglutination, and the activity of specific enzymes requiring disulfide bonds for their structural integrity .

How do CjDsbA1 and CjDsbA2 differ in substrate specificity and function?

CjDsbA1 and CjDsbA2 exhibit significant differences in their substrate spectra despite their sequence homology. CjDsbA1 appears to be the primary oxidative folding catalyst in C. jejuni cells, with broader substrate specificity affecting multiple life processes. In contrast, CjDsbA2 has a more limited substrate range, with its oxidative folding activity demonstrated primarily for arylsulfotransferase CjAstA . The results from functional analyses suggest that CjDsbA2 cooperates with CjDsbB for reoxidation, while CjDsbA1 likely has another, as yet unidentified, protein partner that acts to re-oxidize it in C. jejuni cells . These differences highlight the complex and specialized nature of the oxidative protein folding systems in C. jejuni.

What methodologies are most effective for characterizing oxidoreductase function in C. jejuni?

Effective characterization of C. jejuni oxidoreductases involves a combination of genetic, biochemical, and bioinformatic approaches. Researchers have successfully employed targeted gene knockout strategies to create mutants lacking specific oxidoreductases, followed by phenotypic analysis to determine their functional roles . For example, studies have demonstrated that in the C. jejuni 81116 cjdsbA1 mutant, PhoX activity reached only 6% of wild type levels, while in cjdsbA2 and cjdsbI mutant strains, it was reduced to 42%, and in the cjdsbB mutant to 53% . These quantitative enzymatic assays provide valuable insights into the specific contributions of each oxidoreductase to the activity of substrate proteins.

How can researchers create effective genetic constructs for studying recombinant C. jejuni proteins?

Construction of marker strains involves techniques such as overlapping PCR protocols and careful insertion of antibiotic resistance genes at neutral genomic loci. For example, researchers have created chloramphenicol resistance (Cm^R) marker strains by amplifying and joining three DNA fragments: the Cm^R gene, upstream flanking region, and downstream flanking region . The resulting cassette can be transformed into electrocompetent C. jejuni cells using electroporation at 2,500 V . Natural transformation can also be employed to transfer deletion cassettes to fresh backgrounds of C. jejuni strains using genomic DNA from confirmed mutants, which helps eliminate any unwanted mutations .

What are the technical challenges in expressing recombinant C. jejuni disulfide oxidoreductases?

Expression of recombinant C. jejuni oxidoreductases faces several challenges, including differences in codon usage between C. jejuni and common expression hosts like E. coli, potential toxicity of overexpressed membrane or redox proteins, and ensuring proper folding and disulfide bond formation in the heterologous expression system. Additionally, C. jejuni's microaerophilic growth requirements can complicate protein expression workflows. When studying oxidoreductases specifically, maintaining the proper redox environment during purification is critical to preserve native activity. Researchers must carefully optimize expression conditions, including temperature, induction timing, and choice of expression host strains specialized for disulfide bond formation.

What role do specific cysteine residues play in C. jejuni substrate proteins?

Analysis of cysteine residues in C. jejuni substrate proteins reveals their critical importance in enzyme activity. For example, the C. jejuni PhoX enzyme possesses five cysteine residues (Cys198, Cys211, Cys399, Cys519, Cys540) that are conserved in its closest homologs . Through site-directed mutagenesis, researchers have determined that only one disulfide bond affects enzyme activity, formed between Cys211–Cys519 (C2–C4) . When point mutations were introduced, changing C198A, C399A, and C540A did not alter PhoX activity, whereas the C211A and C519A mutations led to significantly reduced activity (to 5% and 50%, respectively) compared to the wild type enzyme . This demonstrates the specific and non-redundant roles of particular cysteine residues in substrate proteins.

How do C. jejuni disulfide oxidoreductases contribute to pathogenesis and virulence?

C. jejuni disulfide oxidoreductases, particularly CjDsbA1, play significant roles in pathogenesis and virulence. CjDsbA1 is described as "the primary thiol-oxidoreductase affecting life processes associated with bacterial spread and host colonization" . The proteins properly folded by these oxidoreductases contribute to C. jejuni's ability to colonize hosts, resist environmental stresses, and cause disease. Understanding these mechanisms provides potential targets for therapeutic intervention. The reduced virulence observed in oxidoreductase mutants highlights the importance of these systems in pathogen-host interactions.

What is the relationship between horizontal gene transfer and genetic diversity in C. jejuni oxidoreductase systems?

C. jejuni exhibits a non-clonal population structure with comparatively high strain-level genetic variation, partly due to horizontal gene transfer (HGT) . Studies have demonstrated that HGT of chromosomally encoded genetic markers between C. jejuni cells occurs in laboratory conditions at a frequency of approximately 0.02811 ± 0.0035% of parental strains . Interestingly, the addition of chicken cecal content increased recombination efficiency approximately 10-fold compared to control conditions, suggesting that HGT in C. jejuni is facilitated in the chicken gut environment, contributing to in vivo genomic diversity . This natural competence and enhanced recombination in host environments may contribute to the diversity observed in oxidoreductase systems across C. jejuni strains.

How can understanding C. jejuni oxidoreductases inform antimicrobial development strategies?

Understanding the structure-function relationships of C. jejuni oxidoreductases provides potential targets for antimicrobial development. Since these enzymes are critical for proper protein folding and bacterial survival, inhibitors targeting these systems could represent a novel class of antimicrobials. The apparent differences between C. jejuni oxidoreductases and their homologs in other bacteria might allow for the development of species-specific inhibitors. Additionally, the identification of multiple, partially redundant oxidative folding pathways in C. jejuni suggests that effective therapeutic strategies might need to target multiple components of these systems simultaneously to overcome functional redundancy.

What expression systems are most suitable for recombinant C. jejuni oxidoreductases?

Selection of appropriate expression systems for C. jejuni oxidoreductases requires careful consideration of several factors. E. coli-based systems with modifications to support proper disulfide bond formation, such as those with enhanced periplasmic oxidizing environments, are often employed. The choice between cytoplasmic and periplasmic expression depends on the specific oxidoreductase being studied and its native cellular localization. For challenging proteins, eukaryotic expression systems may provide advantages in terms of protein folding and post-translational modifications. Each system presents trade-offs between yield, ease of use, cost, and ability to produce correctly folded, active protein.

What purification strategies optimize yield and activity of C. jejuni oxidoreductases?

Purification of C. jejuni oxidoreductases requires strategies that maintain their redox state and structural integrity. Affinity chromatography using carefully positioned tags that don't interfere with the active site is commonly employed as an initial purification step. Buffer conditions must be optimized to prevent non-specific disulfide bond formation or reduction during purification. Adding appropriate redox buffers containing defined ratios of oxidized and reduced glutathione or other thiol compounds helps maintain the correct redox state. Activity assays should be performed throughout purification to ensure that functional protein is being recovered. Size exclusion chromatography as a final step helps ensure homogeneity and remove any aggregated protein.

How should researchers interpret conflicting data regarding oxidoreductase function in different C. jejuni strains?

When faced with conflicting data regarding oxidoreductase function across different C. jejuni strains, researchers should consider several factors. First, strain-specific genetic differences may result in genuine functional variations in oxidoreductase systems. C. jejuni's high genetic diversity, enhanced by horizontal gene transfer in host environments , contributes to strain-specific adaptations. Researchers should carefully document strain information, growth conditions, and experimental methodologies to facilitate meaningful comparisons. Meta-analysis approaches combining data from multiple studies can help identify consistent patterns versus strain-specific effects. When possible, performing comparative experiments with multiple strains under identical conditions provides the most direct evidence for strain-specific differences in oxidoreductase function.

What bioinformatic approaches best predict substrate interactions for C. jejuni oxidoreductases?

Bioinformatic prediction of substrate interactions for C. jejuni oxidoreductases involves multiple computational approaches. Structure-based methods, including molecular docking and molecular dynamics simulations, can predict interactions between oxidoreductases and potential substrate proteins when structural data is available. Sequence-based approaches examining the conservation of cysteine residues and their spacing can identify potential disulfide bonds, as demonstrated with the DiANNA server for predicting disulfide connectivity in proteins like C. jejuni PhoX . Comparative genomic approaches analyzing co-evolution patterns between oxidoreductases and potential substrates can provide additional evidence for functional relationships. Integration of multiple predictive methods, followed by experimental validation, provides the most reliable approach for identifying new substrates of C. jejuni oxidoreductases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.