Recombinant Campylobacter jejuni subsp. doylei ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Campylobacter jejuni and ATP Synthase

Campylobacter jejuni is a Gram-negative, microaerophilic bacterium that represents one of the leading causes of bacterial gastroenteritis worldwide. This pathogen can cause severe diarrheal disease and, in some cases, may progress to bacteremia, particularly with certain clonal lineages . C. jejuni subspecies doylei represents a distinct taxonomic group within the C. jejuni species that possesses unique genetic and phenotypic characteristics compared to the more commonly studied subspecies jejuni.

ATP synthase represents a critical enzyme complex in C. jejuni's energy metabolism pathway. This multisubunit protein complex spans the bacterial membrane and functions as a molecular machine that harnesses the energy of the proton motive force (pmf) to synthesize ATP, the universal energy currency of cells. The ATP synthase complex consists of two main functional units: the membrane-embedded F0 sector, which contains the proton channel, and the cytoplasmic F1 sector, which houses the catalytic sites for ATP synthesis .

Structure and Function

The ATP synthase subunit a, encoded by the atpB gene, constitutes a critical component of the F0 sector of the ATP synthase complex. This integral membrane protein contains multiple transmembrane helices that form part of the proton channel through the bacterial membrane. The protein's structure is highly conserved across bacterial species, reflecting its essential function in energy metabolism.

In C. jejuni, the ATP synthase complex plays a crucial role in generating ATP through oxidative phosphorylation, a process that is tightly linked to the proton motive force (pmf) . The membrane potential (Δψ), a major component of the pmf, is essential for ATP synthesis, nutrient transport, and flagellar rotation in this organism . Research has demonstrated that C. jejuni can generate a relatively high membrane potential through respiration using either formate as an electron donor or oxygen as an electron acceptor, highlighting the importance of ATP synthase in the organism's metabolic flexibility .

Comparison Between C. jejuni Subspecies

While limited specific information is available about the ATP synthase subunit a in C. jejuni subspecies doylei, insights can be gained from studies on related subspecies. The ATP synthase subunit a (atpB) in C. jejuni subspecies jejuni serotype O:23/36 has been characterized as an integral membrane protein that functions within the F0 sector of the ATP synthase complex . This protein is also known by alternative names including "ATP synthase F0 sector subunit a" and "F-ATPase subunit 6" .

Comparative genomic studies of different C. jejuni strains have revealed variations in metabolic and physiological capabilities, which may extend to differences in energy metabolism pathways including ATP synthesis . These genomic differences could potentially influence the structure, function, or regulation of ATP synthase components, including the atpB-encoded subunit a.

Recombinant Protein Expression and Purification

The production of recombinant Campylobacter jejuni ATP synthase subunit a involves expression in heterologous host systems. For the subspecies jejuni, recombinant atpB has been successfully expressed in yeast expression systems, yielding protein preparations with purity exceeding 85% as determined by SDS-PAGE analysis . Similar expression strategies could potentially be applied to the production of recombinant atpB from C. jejuni subspecies doylei.

Commercially available recombinant ATP synthase subunit a proteins, such as those from subspecies jejuni, are typically provided as partial protein constructs rather than full-length proteins . This may reflect challenges in expressing complete transmembrane proteins in heterologous systems or could be due to specific functional studies focusing on particular domains of the protein.

Energy Metabolism and Membrane Potential

The ATP synthase complex, including the atpB-encoded subunit a, plays a central role in C. jejuni's energy metabolism. Studies have demonstrated that the generation of a membrane potential (Δψ) in C. jejuni depends on specific electron donors and acceptors, with a relatively high membrane potential observed when either formate is available as an electron donor or oxygen serves as an electron acceptor .

This membrane potential is essential for multiple cellular processes, including:

  • ATP synthesis through oxidative phosphorylation

  • Nutrient transport across the cell membrane

  • Flagellar rotation enabling bacterial motility

It is noteworthy that ATP generation in C. jejuni is not exclusively dependent on oxidative phosphorylation via the pmf but can also occur through substrate-level phosphorylation mediated by enzymes such as AckA . This metabolic flexibility may contribute to the organism's ability to survive in diverse environmental niches.

Adaptation to Environmental Conditions

C. jejuni demonstrates remarkable adaptability to changing environmental conditions, particularly varying oxygen levels. In response to low oxygen tension, C. jejuni increases the transcription and activity of electron donor complexes like formate dehydrogenase (FdhABC) and hydrogenase (HydABCD), as well as the transcription of alternative respiratory acceptor complexes . Given the central role of ATP synthase in energy metabolism, it is likely that the regulation of atpB expression and ATP synthase activity is coordinated with these adaptive responses.

Research suggests that in the gut of warm-blooded animals, C. jejuni depends on either formate or hydrogen as electron donors (in the anaerobic lumen) or oxygen as an electron acceptor (near epithelial cells) to generate the pmf necessary for efficient motility and growth, which are critical for successful colonization and pathogenesis .

ATP-Dependent Transport Systems in C. jejuni

In addition to the direct role of ATP synthase in energy production, ATP fuels various transport systems that contribute to C. jejuni pathogenesis. Amino acid ATP binding cassette (AA-ABC) transporters have been identified as important pathogenesis factors in C. jejuni . These transport systems use ATP hydrolysis to actively transport substrates across the bacterial membrane and have been linked to important physiological processes and pathogenesis mechanisms.

Specific AA-ABC transporter systems in C. jejuni include:

  • The glutamate/aspartate substrate binding protein Peb1

  • The cysteine binding protein CjaA

  • The SdaA and SdaC serine transporters

  • The pathogenesis-associated glutamine ABC transporter system (encoded by paqP and paqQ)

Functional studies of these ATP-dependent transporters have revealed their roles not only in nutrient acquisition but also in stress tolerance and host cell interactions. For example, mutations in the paqP and paqQ genes, which encode components of a glutamine-specific AA-ABC transporter, resulted in altered resistance to environmental stresses and affected host cell responses during infection .

Implications for Research and Therapeutic Development

The critical role of ATP synthase and ATP-dependent processes in C. jejuni survival and pathogenesis suggests potential targets for therapeutic intervention. Inhibition of ATP synthesis or utilization could potentially disrupt multiple essential functions, including:

  • Energy generation through oxidative phosphorylation

  • Membrane potential maintenance

  • Nutrient transport

  • Motility

  • Stress response mechanisms

Further investigation of the structure, function, and regulation of ATP synthase components, including the atpB-encoded subunit a, may reveal species- or strain-specific features that could be targeted for the development of novel antimicrobial strategies.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us and we will prioritize development according to your request.
Synonyms
atpB; JJD26997_0526; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Target Names
atpB
Target Protein Sequence
MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLAEAFLEGVL SMGRDTMGSEKGVRKYLPLVATLGIIVFFSNIIGILPGFHAPTASLNLTLSLAIIVFVYY HFEGIRAQGFIKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEKGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of atpB in Campylobacter jejuni ATP synthase?

AtpB (ATP synthase subunit a) is a membrane-embedded component of the F0 sector of ATP synthase in C. jejuni. According to protein sequence data, C. jejuni subsp. doylei atpB consists of 226 amino acids with a specific sequence that includes hydrophobic regions necessary for membrane integration . The protein is encoded by the atpB gene (locus JJD26997_0526) .

Functionally, atpB forms part of the proton channel in the F0 sector that facilitates proton movement across the membrane. This proton flow is essential for driving the rotation of ATP synthase's rotor components, which ultimately powers ATP synthesis in the F1 sector. In bacterial systems like C. jejuni, this rotational mechanism can be remarkably efficient, with ATP synthase capable of synthesizing approximately 400 ATP molecules per second under optimal conditions .

How does atpB contribute to energy metabolism in C. jejuni?

AtpB plays a crucial role in C. jejuni's energy metabolism by participating in oxidative phosphorylation. The protein functions within the ATP synthase complex to harness the proton motive force (pmf) generated by the electron transport chain.

Research demonstrates that C. jejuni depends on a sufficient membrane potential (Δψ), the major component of pmf, for both motility and growth . This membrane potential is only generated efficiently when specific electron donor/acceptor pairs are available - either formate as an electron donor or oxygen as an electron acceptor, combined with a complementary acceptor or donor respectively .

The atpB subunit's proton channel activity directly couples this membrane potential to ATP production. This energy conversion system is especially important for C. jejuni's adaptation to different microenvironments in the host gut, where electron donors and acceptors vary between the anaerobic lumen (using formate or hydrogen as donors) and the oxygen-rich epithelial surface (using oxygen as an acceptor) .

How is atpB genetically conserved across Campylobacter species?

While the search results don't provide specific conservation data across all Campylobacter species, we know that the atpB gene in C. jejuni subsp. doylei strain ATCC BAA-1458/RM4099/269.97 has been identified with UniProt accession number A7H2H4 . Researchers investigating conservation should:

  • Perform multiple sequence alignments of atpB across Campylobacter species and strains

  • Calculate sequence identity and similarity percentages

  • Identify conserved functional domains and motifs

  • Map conservation onto predicted structural models

Conservation analysis would likely reveal highest preservation in regions essential for proton translocation and interaction with other ATP synthase subunits, while peripheral regions might show greater variability.

What are the optimal conditions for expressing and purifying recombinant C. jejuni atpB?

For successful expression and purification of recombinant C. jejuni atpB, researchers should consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are typically preferred for membrane protein expression

  • Consider using specialized strains for toxic or difficult-to-express membrane proteins

  • C41(DE3) or C43(DE3) strains may improve yields for membrane proteins

Vector Design:

  • Include affinity tags (His6, FLAG, etc.) to facilitate purification

  • Consider fusion partners (MBP, SUMO, etc.) to enhance solubility

  • Include protease cleavage sites for tag removal if needed for functional studies

Expression Conditions:

  • Lower induction temperatures (16-25°C) often improve membrane protein folding

  • Extended expression periods (overnight to 24 hours) at lower temperatures

  • IPTG concentration optimization (typically 0.1-0.5 mM)

Purification Strategy:

  • Membrane extraction using detergents (DDM, LDAO, or similar mild detergents)

  • Affinity chromatography as primary purification step

  • Size exclusion chromatography for further purification and quality assessment

Once purified, the protein should be stored according to established guidelines - in Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended periods, avoiding repeated freeze-thaw cycles .

What analytical methods are most effective for studying atpB function?

Several analytical approaches can be employed to study atpB function, each providing different insights:

Membrane Potential Measurements:

  • Fluorescent probes (e.g., DiSC3(5)) to monitor changes in membrane potential

  • Patch-clamp techniques for direct electrophysiological measurements

  • Measurement of proton translocation using pH-sensitive dyes

ATP Synthesis Assays:

  • Luciferase-based ATP quantification assays, similar to those used in C. jejuni studies measuring ATP content of different cell morphotypes

  • Real-time ATP synthesis monitoring using coupled enzyme assays

  • 32P-labeled ADP incorporation assays for direct measurement of ATP synthesis

Structural Analysis:

  • Cryo-electron microscopy for structural determination within the ATP synthase complex

  • Hydrogen-deuterium exchange mass spectrometry to investigate dynamic conformational changes

  • Förster resonance energy transfer (FRET) to measure distances between labeled components

Interaction Studies:

  • Crosslinking studies to identify interacting partners

  • Co-immunoprecipitation to verify protein-protein interactions

  • Blue native PAGE to analyze complex assembly

A particularly valuable approach demonstrated in C. jejuni research involves correlating ATP production with cellular phenotypes. For example, researchers have measured ATP content in different C. jejuni morphotypes (spiral, filamentous, and coccoid), finding significant differences that correlate with cellular viability .

How can researchers assess atpB's role in proton translocation?

To evaluate atpB's specific contribution to proton translocation in C. jejuni ATP synthase:

Site-Directed Mutagenesis Approach:

  • Identify conserved residues in atpB likely involved in proton translocation

  • Create point mutations in these residues

  • Express mutant proteins in a C. jejuni atpB deletion background

  • Measure effects on:

    • Proton translocation efficiency

    • ATP synthesis rates

    • Growth under different energetic conditions

    • Membrane potential generation

Reconstitution Studies:

  • Purify wild-type and mutant atpB proteins

  • Reconstitute into liposomes with other ATP synthase components

  • Measure proton pumping using pH-sensitive fluorescent dyes

  • Compare activities under different conditions

Inhibitor Studies:

  • Use specific ATP synthase inhibitors (e.g., DCCD, oligomycin)

  • Determine effects on proton translocation

  • Identify inhibitor binding sites through resistance mutations or direct binding studies

These approaches should be conducted with appropriate controls, including comparison to strains with known atpB mutations or deletions.

How does membrane lipid composition impact atpB function in C. jejuni?

The interaction between atpB and the lipid environment is a critical but often overlooked aspect of ATP synthase function. Current research emphasizes that ATP synthases are significantly impacted by the membranes within which they reside .

For C. jejuni atpB research, consideration of lipid-protein interactions should include:

Methodological Approaches:

  • Reconstitution of atpB in liposomes with defined lipid compositions

  • Measurement of proton translocation efficiency in different lipid environments

  • Analysis of protein stability and conformation in various membrane mimetics

  • Molecular dynamics simulations of atpB-lipid interactions

Key Considerations:

  • Lipid headgroup composition effects on proton channel activity

  • Membrane thickness matching with hydrophobic regions of atpB

  • Effects of membrane fluidity on conformational changes during catalysis

  • Specific lipid requirements for optimal function

A comprehensive understanding of atpB would integrate structural studies with lipid interaction analysis, as membrane proteins like atpB have evolved within specific lipid environments that may be crucial for their function .

What is the relationship between atpB function and C. jejuni pathogenesis?

While atpB is not a classical virulence factor, its role in energy metabolism makes it indirectly important for C. jejuni pathogenesis:

Pathogenesis Connection:
C. jejuni requires a functioning proton motive force (pmf) for both effective motility and growth, which are essential for colonization and pathogenesis . The ATP synthase complex, including atpB, is central to maintaining this pmf under varying host conditions.

Research shows that in the gut environment, C. jejuni depends on either formate/hydrogen as electron donors (in the anaerobic lumen) or oxygen as an electron acceptor (near epithelial cells) to generate sufficient pmf for colonization . The ability of ATP synthase to function efficiently under these varying conditions depends partly on atpB's proton translocation activity.

Research Approaches:

  • Creation of atpB mutants with altered proton translocation efficiency

  • Assessment of these mutants for:

    • Motility in viscous media (mimicking intestinal mucus)

    • Ability to withstand pH fluctuations in the GI tract

    • Colonization potential in animal models

    • Competitive fitness during infection

  • Correlation between ATP synthesis capacity and virulence traits

This research direction could reveal whether atpB might represent a potential antimicrobial target, given that disruption of energy metabolism could attenuate pathogenesis.

How does C. jejuni atpB compare structurally and functionally with atpB from other bacterial pathogens?

Comparative analysis of ATP synthase subunit a across bacterial species reveals important evolutionary adaptations:

Structural Comparisons:
ATP synthase components show significant variation across taxa in features including:

  • Ion channel selectivity (H+ vs. Na+)

  • Rotor ring size and stoichiometry

  • Interactions with membrane lipids

These variations reflect adaptation to different energetic environments and constraints.

Methodological Approach for Comparison:

  • Multiple sequence alignment of atpB sequences from diverse pathogens

  • Homology modeling based on available ATP synthase structures

  • Identification of conserved vs. variable regions

  • Functional testing of chimeric proteins with domains from different species

Research Applications:

  • Understanding bacterial adaptation to specific niches

  • Identifying species-specific features that could be targeted by antimicrobials

  • Engineering ATP synthases with altered properties for biotechnological applications

This comparative approach provides insights into both fundamental evolutionary biology and potential species-specific therapeutic targets.

What technical challenges arise when working with recombinant atpB and how can they be addressed?

Researchers face several significant challenges when working with recombinant C. jejuni atpB:

Challenge 1: Membrane Protein Expression

  • Problem: Low expression yields and protein aggregation

  • Solutions:

    • Use specialized expression strains (C41/C43, Lemo21)

    • Optimize induction parameters (temperature, inducer concentration)

    • Consider cell-free expression systems

    • Employ fusion partners that enhance membrane protein folding

Challenge 2: Maintaining Functional Conformation

  • Problem: Loss of native structure during purification

  • Solutions:

    • Screen multiple detergents for optimal extraction and stability

    • Use lipid nanodiscs or amphipols to maintain native-like membrane environment

    • Minimize time between membrane extraction and reconstitution

    • Include specific lipids known to stabilize ATP synthase components

Challenge 3: Functional Assessment of Isolated Subunit

  • Problem: atpB functions as part of a complex, making isolated assessment difficult

  • Solutions:

    • Co-express with minimal functional partners

    • Develop subunit-specific assays (e.g., proton permeability in liposomes)

    • Use complementation assays in atpB-deficient strains

Challenge 4: Protein Stability

  • Problem: Rapid degradation during storage

  • Solutions:

    • Store at -20°C in Tris-based buffer with 50% glycerol for regular use

    • Use -80°C for extended storage

    • Prepare small working aliquots to avoid freeze-thaw cycles

    • Include protease inhibitors during purification and storage

How does ATP content vary across C. jejuni morphotypes and what implications does this have for atpB research?

Studies of C. jejuni have revealed significant variation in ATP content across different cell morphotypes, which has important implications for atpB research:

ATP Content Variation Data:

Cell MorphotypeC. jejuni StrainGrowth PhaseATP Content (fg ATP/CFU)
Spiral12661Exponential0.99
SpiralPT14Exponential1.7
Filamentous12661Decline17.4
FilamentousPT14Decline2.66
Coccoid12661/PT14Late DeclineVery low/undetectable

Data derived from

Research Implications:

  • Physiological State Consideration: ATP content varies dramatically with cell morphology and growth phase, requiring careful experimental design when studying atpB function.

  • Viability Assessment: The extremely low ATP content in coccoid forms suggests they may not be viable, despite being abundant in older cultures . This impacts how researchers should interpret results from mixed-morphology populations.

  • Strain Variation: Different C. jejuni strains show distinct ATP content patterns, particularly in filamentous forms (12661 has ~6.5× higher ATP content than PT14) . This suggests potential strain-specific differences in ATP synthase activity that should be considered when selecting experimental strains.

  • Methodological Approach: For accurate assessment of atpB function, researchers should:

    • Characterize the morphological composition of cultures

    • Consider cell sorting to isolate specific morphotypes

    • Account for strain-specific differences in ATP production capacity

    • Control for growth phase effects on ATP synthase activity

These considerations are essential for designing well-controlled experiments that produce reliable and reproducible results when studying atpB function in C. jejuni.

What emerging technologies could enhance our understanding of C. jejuni atpB?

Several cutting-edge technologies show promise for advancing C. jejuni atpB research:

Cryo-Electron Microscopy:
High-resolution structural determination of the complete C. jejuni ATP synthase complex would provide unprecedented insights into atpB's interactions with other subunits and the membrane. Recent advances in cryo-EM have enabled visualization of the complete F-type ATP synthase from other organisms, including rotation of the γ-subunit at >130 Hz .

Single-Molecule Techniques:
Technologies that monitor individual molecule behavior could reveal dynamic aspects of atpB function:

  • Single-molecule FRET to track conformational changes during proton translocation

  • High-speed AFM to visualize structural dynamics in native-like membrane environments

  • Optical tweezers to measure forces associated with proton movement and ATP synthesis

Advanced Genetic Engineering:
CRISPR-Cas9 genome editing in C. jejuni would enable:

  • Precise point mutations in atpB to study structure-function relationships

  • Fluorescent protein tagging for localization studies

  • Rapid generation of multiple mutants for comparative studies

Computational Approaches:

  • Molecular dynamics simulations of atpB in complex lipid environments

  • Machine learning for predicting effects of mutations on function

  • Systems biology approaches integrating atpB function with global cellular energetics

How might atpB research contribute to antimicrobial development against Campylobacter infections?

Given the rising antimicrobial resistance in Campylobacter species , research on atpB could contribute to novel therapeutic strategies:

Target Validation Approach:

  • Determine if atpB functionality is essential for C. jejuni survival under relevant host conditions

  • Assess whether partial inhibition of atpB function could attenuate virulence without selecting for resistance

  • Evaluate conservation of potential drug-binding sites across Campylobacter strains

  • Test susceptibility of drug-resistant clinical isolates to ATP synthase inhibitors

Screening Methodology:

  • Develop high-throughput assays specific for C. jejuni ATP synthase activity

  • Screen for compounds that specifically inhibit C. jejuni atpB function

  • Perform structure-activity relationship studies of promising leads

  • Assess selectivity by comparing effects on bacterial versus human ATP synthase

Combination Strategy Development:
Research shows that C. jejuni can generate ATP through both oxidative phosphorylation and substrate-level phosphorylation via AckA . Therapeutic approaches might target both pathways simultaneously to prevent metabolic adaptation.

This research direction is particularly promising given the high rates of antimicrobial resistance observed in Campylobacter isolates (67-100% resistance to ciprofloxacin and tetracycline; 22-33% resistance to erythromycin) , highlighting the need for novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.