Recombinant Campylobacter jejuni subsp. doylei Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

plsY belongs to the glycerol-3-phosphate acyltransferase (GPAT) family, which initiates glycerolipid biosynthesis in bacteria. In C. jejuni subsp. doylei, this enzyme facilitates:

  • Prokaryotic Membrane Synthesis: Acylation of G3P using acyl-ACP as a substrate, producing LPA for phosphatidylglycerol (PG) and other membrane lipids .

  • Pathogen Survival: Lipid metabolism is critical for membrane integrity and adaptation to host environments, particularly in subspecies doylei, which is frequently isolated from bacteremia cases .

While C. jejuni subsp. jejuni dominates clinical isolates, doylei strains exhibit distinct genomic features, including reduced virulence factors like cytolethal distending toxin (CDT) . The presence of plsY in doylei underscores its reliance on lipid metabolism for survival.

ELISA-Based Detection

Recombinant plsY is used in enzyme-linked immunosorbent assays (ELISA) to study antibody responses or protein interactions. Key features of commercial ELISA kits include:

Kit ComponentDetails
Target AntigenRecombinant plsY (50 µg/vial)
Storage BufferTris-based buffer, 50% glycerol (pH 8.0)
ApplicationsSerological studies, protein interaction assays, vaccine development

These kits enable precise quantification of plsY in experimental systems .

Recombinant Protein Production

The His-tagged plsY is purified via nickel affinity chromatography, enabling structural and functional studies. Applications include:

  • Enzyme Kinetics: Determining substrate specificity (e.g., G3P vs. alternative acceptors).

  • Structural Biology: Crystallization studies to elucidate catalytic mechanisms.

Subspecies-Specific Context

C. jejuni subsp. doylei (Cjd) diverges genetically from C. jejuni subsp. jejuni (Cjj), with fewer genes encoding virulence factors and integrated elements . While Cjd retains core metabolic pathways, its lipid synthesis machinery, including plsY, may exhibit functional adaptations. For example:

  • Glycerol-3-Phosphate Utilization: C. jejuni expresses a GlpT transporter for G3P uptake, suggesting its importance in lipid precursors .

  • Pathogenicity Trade-offs: Reduced virulence factors in Cjd may shift metabolic priorities toward membrane synthesis, potentially involving plsY .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; JJD26997_1601; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Target Names
plsY
Target Protein Sequence
MENLIIYAFIYLLGSISFGLILTKFFAKTDIKKEGSRSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWAVTGKIFKISSLASLAALLAFIVSSFIFNYDLEIHTHAPVFIIAF IIVYKHLPNIKRLIFKEECKVI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not accept acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Campylobacter jejuni?

Glycerol-3-phosphate acyltransferase (plsY) is a key enzyme involved in bacterial phospholipid biosynthesis, specifically catalyzing the transfer of an acyl group to glycerol-3-phosphate. In Campylobacter jejuni, this enzyme (EC 2.3.1.n3) is critical for membrane lipid formation, participating in the initial steps of phospholipid synthesis. The enzyme is also known by several alternative names including Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, and G3P acyltransferase (GPAT) . As an integral membrane protein, plsY is essential for bacterial viability and has gained attention as a potential antimicrobial target due to its crucial role in bacterial cell membrane integrity.

How does C. jejuni plsY compare with homologous enzymes from other bacterial species?

Comparative analysis of C. jejuni plsY with homologous enzymes from other bacterial species reveals both conserved features and species-specific adaptations. While the catalytic mechanism is generally conserved across bacterial plsY enzymes, C. jejuni plsY shows distinct sequence variations that may reflect adaptation to its unique ecological niche and membrane composition requirements. Unlike some other bacterial species, C. jejuni utilizes specific pathways for membrane lipid biosynthesis, including the synthesis of unusual sugars like dTDP-Fuc3N or dTDP-Qui3N that contribute to its lipooligosaccharide (LOS) structure .

Genomic context analysis indicates that plsY is part of the core genome in Campylobacter species, though the genetic elements surrounding it may vary across strains. This variability is highlighted by comparative genomic hybridization (CGH) studies that have identified numerous intraspecies hypervariable regions in C. jejuni . These variations in genomic context may influence plsY expression patterns and potentially its functional characteristics across different Campylobacter strains.

What are the optimal storage and handling conditions for recombinant C. jejuni plsY?

For optimal enzyme activity and stability, recombinant C. jejuni subsp. doylei Glycerol-3-phosphate acyltransferase (plsY) requires specific storage and handling protocols. The enzyme should be stored at -20°C for regular use, and at -80°C for extended storage periods . The recommended storage buffer consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability .

When working with the enzyme, it's crucial to avoid repeated freeze-thaw cycles as these can significantly diminish enzyme activity. Instead, prepare working aliquots and store them at 4°C for up to one week of continuous use . When thawing frozen samples, do so gradually on ice to minimize protein denaturation. For experimental work, the enzyme performs optimally when maintained in its recommended buffer system at appropriate pH (typically pH 7.0-8.0 for most acyltransferases), though specific pH optimization may be necessary depending on the experimental conditions.

What expression systems are most effective for producing active recombinant C. jejuni plsY?

Producing catalytically active recombinant C. jejuni plsY presents challenges due to its membrane-associated nature. While the search results don't specify the expression system used for the commercially available protein, established protocols for similar membrane proteins suggest several effective approaches.

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli BL21(DE3)High yield, cost-effectivePotential improper foldingRequires careful optimization of induction conditions
E. coli C41/C43Specialized for membrane proteinsLower yield than standard strainsBetter for toxic membrane proteins
Insect cell systemsBetter for complex foldingHigher cost, longer production timeMay provide more native-like post-translational modifications
Cell-free expressionAvoids toxicity issuesLimited scalabilityAllows direct incorporation into lipid environments

For optimal expression, inducing protein production at lower temperatures (16-25°C) can significantly improve the yield of properly folded enzyme. Additionally, inclusion of specific membrane-mimicking environments such as detergents or lipid nanodiscs in the purification process can help maintain the enzyme's native conformation and activity.

What enzymatic assays are most reliable for measuring C. jejuni plsY activity?

Several robust assays can be employed to accurately measure C. jejuni plsY acyltransferase activity:

  • Radiometric assay: This high-sensitivity approach uses radiolabeled substrates (typically 14C-labeled glycerol-3-phosphate or acyl donors) to monitor product formation. The reaction products are separated by thin-layer chromatography or liquid chromatography and quantified by scintillation counting.

  • Spectrophotometric coupled assay: This continuous assay couples plsY activity to the oxidation of NADH (monitored at 340 nm) through auxiliary enzymes, allowing real-time measurement of reaction kinetics.

  • HPLC-based methods: These methods separate and quantify reaction products using high-performance liquid chromatography, often coupled with mass spectrometry for product identification.

  • Fluorescence-based assays: Using fluorescently-labeled substrates or coupled reactions that produce fluorescent signals can provide sensitive detection of enzyme activity.

For accurate activity measurements, it's critical to establish reaction conditions that mimic the native environment of this membrane-bound enzyme. This typically involves incorporating appropriate phospholipids or detergents in the reaction mixture to create a membrane-like microenvironment. Additionally, careful consideration of substrate concentrations is essential, particularly at subsaturating glycerol-3-phosphate levels where the flux through glycerophosphate acyltransferase can become rate-limiting for the esterification process .

How can structural studies of C. jejuni plsY inform antimicrobial development?

Structural characterization of C. jejuni plsY offers significant potential for antimicrobial development through structure-based drug design approaches. As a key enzyme in bacterial phospholipid biosynthesis with no human homolog, plsY represents an attractive target for selective inhibition. Advanced structural studies using X-ray crystallography or cryo-electron microscopy can reveal the precise architecture of the active site and substrate-binding pockets.

These structural insights enable rational design of small molecule inhibitors that specifically target the catalytic mechanism of plsY. Particular focus should be placed on identifying compounds that interact with conserved catalytic residues while exploiting unique structural features of C. jejuni plsY. Molecular docking studies can screen virtual compound libraries against the enzyme structure to identify promising candidates for experimental validation.

The membrane-embedded nature of plsY presents specific challenges for structural determination. Techniques such as lipidic cubic phase crystallization or incorporation into nanodiscs can help maintain the native conformation during structural studies. Integrating structural data with molecular dynamics simulations can further elucidate the enzyme's catalytic mechanism and substrate specificity, providing additional targets for inhibitor design.

What is the role of plsY in C. jejuni pathogenesis and host interaction?

The relationship between plsY activity and Campylobacter jejuni pathogenesis remains an active area of investigation. As a key enzyme in phospholipid biosynthesis, plsY contributes to membrane integrity and composition, which directly influences bacterial survival during host colonization. The enzyme may play critical roles in adapting membrane fluidity and permeability in response to environmental stresses encountered during infection.

Research into C. jejuni lipid metabolism suggests interconnections between phospholipid biosynthesis and the production of virulence-associated structures such as lipooligosaccharides (LOS). C. jejuni employs specific pathways to synthesize unusual sugars like dTDP-Fuc3N or dTDP-Qui3N that contribute to its LOS structure, which is implicated in host immune evasion and clinical manifestations of campylobacteriosis . While direct evidence linking plsY to these processes requires further investigation, the enzyme's central role in lipid metabolism suggests potential involvement in virulence factor production.

Genomic diversity studies have identified significant variation in lipid metabolism genes among C. jejuni strains. Comparative genomic analyses have revealed multiple hypervariable regions in C. jejuni genomes, including those associated with lipooligosaccharide biosynthesis, which may influence strain-specific virulence characteristics . Understanding how plsY activity varies across strains with different pathogenic potential could provide insights into its contribution to virulence.

How does plsY activity correlate with antimicrobial resistance mechanisms in C. jejuni?

The relationship between plsY activity and antimicrobial resistance in C. jejuni represents a complex but promising area of research. As a key enzyme in membrane phospholipid biosynthesis, alterations in plsY function can potentially influence membrane permeability and composition, thereby affecting antimicrobial penetration and efflux mechanisms.

Research should examine whether exposure to antimicrobials induces changes in plsY expression or activity as part of the bacterial adaptive response. Quantitative analyses comparing plsY expression levels in susceptible versus resistant C. jejuni strains could reveal whether the enzyme plays a role in resistance phenotypes. Additionally, investigating potential modifications in the phospholipid composition of resistant strains might uncover associations between altered plsY activity and specific resistance mechanisms.

The genomic context of plsY may also be relevant to resistance. Comparative genomic analyses have identified multiple integrated elements and hypervariable regions in C. jejuni genomes that exhibit strain-specific patterns . Determining whether plsY variations correlate with the presence of specific integrated elements associated with resistance genes could provide insights into coevolution of membrane physiology and antimicrobial resistance.

What are common challenges in working with recombinant C. jejuni plsY and how can they be addressed?

Researchers working with recombinant C. jejuni plsY frequently encounter several technical challenges that can impact experimental outcomes. Understanding these issues and implementing appropriate solutions is crucial for successful studies:

  • Protein solubility and stability issues: As a membrane-associated enzyme, plsY can exhibit poor solubility and stability in aqueous solutions.

    • Solution: Incorporate appropriate detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) or lipid environments in buffers. Optimize buffer composition with stabilizing agents such as glycerol (recommended at 50% for storage) .

  • Loss of activity during purification: The enzyme may lose catalytic activity during extraction from membranes and purification steps.

    • Solution: Employ gentle purification methods, maintain cold temperatures throughout processing, and include protease inhibitors to prevent degradation.

  • Inconsistent activity measurements: Variability in assay results can occur due to the enzyme's dependence on a membrane-like environment.

    • Solution: Standardize reaction conditions by incorporating defined lipid compositions, ensure consistent substrate quality, and establish robust internal controls for activity measurements.

  • Substrate specificity determination: Identifying the native acyl donor preferences can be challenging.

    • Solution: Test multiple acyl donors with varying chain lengths and saturations under physiologically relevant conditions. Consider that at subsaturating glycerol-3-phosphate concentrations, the flux through glycerophosphate acyltransferase necessarily limits the esterification process .

  • Expression yield limitations: Obtaining sufficient quantities of properly folded enzyme can be difficult.

    • Solution: Optimize expression conditions including temperature, induction parameters, and host strain selection. Consider using specialized strains designed for membrane protein expression.

How can researchers effectively study plsY interaction with other components of the phospholipid biosynthesis pathway?

Investigating plsY interactions with other components of the phospholipid biosynthesis pathway requires specialized approaches to capture the complexity of membrane-associated multienzyme systems:

  • Reconstitution in liposomes or nanodiscs: Create minimal synthetic membrane systems incorporating plsY and potential pathway partners to study sequential enzymatic activities in a controlled environment.

  • Pull-down assays and co-immunoprecipitation: Use tagged versions of plsY to identify interacting proteins from cell lysates, being careful to maintain membrane integrity during extraction.

  • Bacterial two-hybrid systems: Adapted for membrane proteins, these genetic approaches can detect protein-protein interactions without requiring protein purification.

  • Proximity labeling methods: Techniques like BioID or APEX2 can identify proteins in close proximity to plsY in its native environment by tagging nearby proteins.

  • Fluorescence resonance energy transfer (FRET): Label plsY and potential interaction partners with appropriate fluorophores to detect interactions through energy transfer when proteins are in close proximity.

For effective pathway reconstitution, it's important to consider the comprehensive enzymatic cascade. In C. jejuni and related organisms, researchers have successfully characterized multienzyme pathways involved in the synthesis of complex molecules like dTDP-Fuc3N or dTDP-Qui3N . Similar approaches can be applied to phospholipid biosynthesis studies, ensuring substrate channeling and enzymatic interdependencies are properly maintained.

What strategies can improve heterologous expression and purification of C. jejuni plsY?

To enhance the heterologous expression and purification of functional C. jejuni plsY, researchers should implement targeted strategies addressing the specific challenges of membrane protein production:

Optimization StageStrategyRationale
Vector designInclude affinity tags (His6, Strep, FLAG)Facilitates purification while minimizing interference with enzyme activity
Use inducible promoters with tight regulationPrevents premature expression that may be toxic to host cells
Expression hostSelect specialized strains (C41/C43, Lemo21)These strains are engineered to tolerate membrane protein overexpression
Consider Campylobacter-optimized codon usageImproves translation efficiency in heterologous hosts
Culture conditionsGrow at lower temperatures (16-20°C)Slows protein synthesis, allowing more time for proper folding
Include membrane-stabilizing additivesHelps maintain native-like membrane environment
Induction parametersUse lower inducer concentrationsReduces expression rate, improving folding efficiency
Extend induction time (overnight or longer)Allows accumulation of correctly folded protein
Extraction methodsUse mild detergents (DDM, LDAO)Effectively solubilizes membrane proteins while preserving structure
Consider detergent screeningDifferent proteins respond optimally to different detergents
Purification protocolInclude lipids in purification buffersStabilizes native conformation throughout purification
Implement on-column refoldingCan recover activity from partially denatured protein

When expressing and purifying membrane proteins like plsY, maintaining appropriate storage conditions is critical. The recommended storage buffer containing Tris-based buffer with 50% glycerol has been optimized specifically for this protein's stability . For long-term storage, the enzyme should be kept at -20°C or -80°C, avoiding repeated freeze-thaw cycles that can diminish activity .

How should researchers interpret kinetic data for C. jejuni plsY and compare it across experimental conditions?

Accurate interpretation of kinetic data for C. jejuni plsY requires careful consideration of several factors specific to membrane-associated enzymes:

  • Michaelis-Menten parameters analysis: When determining Km and Vmax values, researchers must account for the membrane environment's influence on substrate accessibility. The traditional Michaelis-Menten model may need modification for two-dimensional catalysis occurring at membrane interfaces.

  • Substrate dependency considerations: At subsaturating glycerol-3-phosphate concentrations, the flux through glycerophosphate acyltransferase necessarily limits esterification processes . Therefore, interpretation of kinetic data should consider substrate availability as a potential rate-limiting factor.

  • Data normalization approaches: For valid comparisons across different experimental conditions, normalize activity data to:

    • Quantified enzyme concentration (determined by methods accounting for membrane protein challenges)

    • Accessible active sites (which may be affected by reconstitution efficiency)

    • Lipid-to-protein ratio (critical for membrane enzyme activity)

  • Environmental variables impact: Systematically evaluate how temperature, pH, ionic strength, and detergent/lipid composition affect kinetic parameters. Present these as three-dimensional response surfaces rather than simple curves to capture complex interactions.

When comparing data across different studies, establish a standardized reporting framework that includes detailed descriptions of the membrane mimetic environment, precise substrate preparations, and comprehensive enzyme characterization. This approach facilitates meaningful cross-study comparisons and contributes to building a coherent understanding of plsY function across different experimental systems.

What bioinformatic approaches are most valuable for analyzing plsY in the context of Campylobacter genomics?

Comprehensive bioinformatic analysis of plsY within the broader context of Campylobacter genomics can reveal important evolutionary and functional insights:

The identification of Campylobacter jejuni-integrated elements (CJIEs) through comparative genomic analysis has demonstrated extensive genomic diversity among C. jejuni strains . Applying similar approaches to plsY and related phospholipid biosynthesis genes could reveal strain-specific adaptations in membrane biology that may correlate with pathogenicity or environmental fitness.

How can researchers effectively correlate plsY activity with membrane composition and bacterial phenotypes?

Establishing meaningful correlations between plsY enzymatic activity, bacterial membrane composition, and resulting phenotypes requires an integrated experimental approach:

  • Lipidomic profiling: Employ advanced mass spectrometry techniques to comprehensively characterize membrane phospholipid composition across:

    • Wild-type vs. plsY mutant strains (if viable)

    • plsY overexpression vs. normal expression conditions

    • Different growth phases and environmental stresses

  • Membrane biophysical property assessment: Measure parameters such as:

    • Membrane fluidity (using fluorescence anisotropy)

    • Phase transition temperatures (differential scanning calorimetry)

    • Lateral organization (super-resolution microscopy with lipid-specific probes)

  • Phenotypic correlation analyses: Systematically evaluate:

    • Growth kinetics under various stress conditions

    • Antimicrobial susceptibility profiles

    • Biofilm formation capacity

    • Host cell adhesion and invasion efficiency

  • Integrated data analysis: Apply multivariate statistical methods (principal component analysis, partial least squares regression) to identify correlations between:

    • plsY expression/activity levels

    • Specific phospholipid species abundance

    • Membrane physical properties

    • Bacterial phenotypic characteristics

This multiparameter approach can reveal how alterations in plsY activity propagate through membrane composition changes to ultimately affect bacterial behavior and adaptation. Understanding these relationships is particularly relevant for C. jejuni, which uses specific pathways to synthesize unusual sugars like dTDP-Fuc3N or dTDP-Qui3N that contribute to its unique membrane structures and potentially to pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.