Recombinant Campylobacter jejuni subsp. doylei Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant C. jejuni subsp. doylei LspA is a recombinant form of the bacterial lipoprotein signal peptidase II (SPase II), an enzyme essential for processing prelipoproteins in Gram-negative bacteria. LspA cleaves the signal peptide from prelipoproteins, enabling their maturation and targeting to the outer membrane . This enzyme is critical for bacterial viability, as its inhibition disrupts membrane protein biogenesis, leading to cell death .

Key Features:

  • Genomic Identification: Encoded by the lspA gene (JJD26997_1596 in strain RM4099) .

  • Function: Processes prelipoproteins (e.g., preICP) into diacylated lipoproteins .

  • Disease Relevance: C. jejuni subsp. doylei is associated with bacteremia and gastroenteritis in humans, with LspA potentially contributing to virulence .

Primary Structure

LspA from C. jejuni subsp. doylei (strain RM4099) exhibits a 156-amino acid sequence with conserved motifs critical for enzymatic activity. Key features include:

DomainSequence Details
N-terminalMAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGLRWQSKYLDLTYALNTGVAFSmLSFLEH
C-terminal...LHKTHSIAFGMmLGAGVSNLLDRFIYGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Active SiteUnknown, but conserved residues (e.g., Asp, Ser, His) likely involved in catalysis .

Source: Recombinant LspA sequence from strain RM4099 .

Comparative Genomics

  • Subspecies-Specific Features: C. jejuni subsp. doylei strains (e.g., RM4099) exhibit distinct genomic divergence from C. jejuni subsp. jejuni, including differences in metabolic and virulence genes .

  • Conservation: LspA is highly conserved within C. jejuni subsp. doylei but shows lower homology with other Campylobacter species (e.g., C. upsaliensis) .

Production Methodology

Recombinant LspA is expressed in heterologous systems (e.g., E. coli) and purified for functional studies:

ParameterDetail
Expression HostE. coli
TagTris-based buffer with 50% glycerol (storage at -20°C) .
PurityHigh-purity recombinant protein suitable for enzymatic assays .
ApplicationsAntibody production (ELISA), inhibitor screening, and structural studies .

Source: Commercial recombinant LspA product specifications .

Enzymatic Activity

LspA processes prelipoproteins via a two-step mechanism:

  1. Lipidation: Preprolipoprotein (preBLP) is lipidated by Lgt to form proBLP.

  2. Cleavage: LspA removes the signal peptide, yielding diacylated BLP .

Assay Methods:

  • SDS-PAGE Shift Assay: Recombinant preproICP is lipidated and cleaved by LspA; the molecular weight shift confirms activity .

  • Inhibition Screening: Cyclic peptides (e.g., G2a, G2d) inhibit LspA, as demonstrated by reduced DA-ICP formation .

Inhibitor Development and Therapeutic Potential

LspA is a validated target for antibiotic development due to its essential role in bacterial survival .

InhibitorStructureMechanismActivity
GlobomycinCyclic depsipeptideCompetitive inhibition of SPase IIIC50: ~1 µM (in vitro) .
G2a/G2dCyclic peptidesTarget LspA active siteEffective in SDS-PAGE assays .

Note: Exact IC50 values for G2a/G2d are not publicly disclosed.

Research Gaps and Future Directions

  1. Structural Elucidation: No crystal structure of LspA is available; NMR or cryo-EM studies are needed.

  2. Species-Specific Variations: Comparative analysis of LspA between C. jejuni subspecies and other Campylobacter spp. is limited .

  3. Therapeutic Translation: In vivo efficacy of LspA inhibitors remains untested.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its inclusion in the manufacturing process.
Synonyms
lspA; JJD26997_1596; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Target Names
lspA
Target Protein Sequence
MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGLRWQSKYLDLTYALNTGVAFSMLSFLEH NLKYLHLALIGVLFIYLFWQKTLLKTHSIAFGMMLGAGVSNLLDRFIYGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What distinguishes Campylobacter jejuni subsp. doylei from C. jejuni subsp. jejuni?

Campylobacter jejuni subsp. doylei (Cjd) differs from C. jejuni subsp. jejuni (Cjj) in several key aspects. The primary phenotypic characteristic used to distinguish Cjd is its inability to reduce nitrate. Other distinguishing features include variable growth at 42°C, high susceptibility to cephalothin, and absence of γ-glutamyl transferase (GGT) and L-arginine arylamidase activity . Clinically, Cjd strains are more frequently associated with bacteremia in addition to gastroenteritis, and are often isolated from pediatric patients . Multilocus sequence typing (MLST) has confirmed that Cjd strains form a phylogenetically distinct clade from Cjj strains, supporting their subspecies designation . Genomically, Cjd exhibits divergence from Cjj in many intraspecies hypervariable regions, with multiple metabolic, transport, and virulence functions (including cytolethal distending toxin) absent in Cjd strains .

How prevalent are lipoproteins in C. jejuni and what is their significance?

The genome of C. jejuni contains over 20 putative lipoproteins, as evidenced in studies characterizing specific lipoproteins like Cj1090c . These lipoproteins serve diverse functions in bacterial physiology, including roles in outer membrane structure, transport systems, adhesion to host cells, and immune modulation. In C. jejuni, specific lipoproteins have been identified as components of essential systems such as the LPS transport (Lpt) system, where lipoproteins like LptE (identified as Cj1090c) form complexes with β-barrel proteins in the outer membrane to facilitate LPS incorporation . The proper processing of these lipoproteins by lipoprotein signal peptidase (lspA) is critical for their correct localization and function, making lspA essential for bacterial viability and pathogenicity.

What is the function of lipoprotein signal peptidase (lspA) in bacterial systems?

Lipoprotein signal peptidase (lspA) plays a crucial role in the biogenesis pathway of bacterial lipoproteins. In this pathway, prolipoproteins are first recognized by their signal peptides containing a conserved "lipobox" motif . After the attachment of a lipid moiety to the cysteine residue within this motif, lspA specifically cleaves the signal peptide, leaving the lipid-modified cysteine as the new N-terminal residue of the mature lipoprotein. This processing step is essential for proper lipoprotein localization to the inner or outer membrane. In Gram-negative bacteria like C. jejuni, lspA is typically an integral membrane protein with multiple transmembrane domains and a catalytic site containing conserved aspartate residues that coordinate a zinc ion. The enzymatic function of lspA is critical for bacterial envelope integrity, stress response, nutrient acquisition, and virulence factor deployment.

What are the optimal conditions for heterologous expression of Cjd lspA?

For heterologous expression of C. jejuni subsp. doylei lspA, a strategic approach is required given its nature as a membrane protein. Based on successful expression of other C. jejuni membrane proteins, the following conditions are recommended:

  • Expression system: E. coli C41(DE3) or C43(DE3) strains are preferred due to their tolerance for membrane protein expression. These strains have adaptations that reduce toxicity associated with membrane protein overexpression.

  • Vector design: A construct containing the mature form of lspA (without signal peptide) fused to an N-terminal His-tag with a TEV protease cleavage site has shown success with similar proteins . The pET system with T7 promoter provides controllable expression.

  • Induction parameters:

    • Temperature: 16-20°C after induction

    • IPTG concentration: 0.1-0.5 mM (lower concentrations often yield better folding)

    • Induction time: 16-20 hours

    • OD600 at induction: 0.6-0.8

  • Growth medium: Terrific Broth supplemented with 0.5% glucose to suppress basal expression and 1 mM ZnSO4 to ensure proper metallation of lspA.

  • Codon optimization: Adaptation of the Cjd lspA sequence to E. coli codon usage may significantly improve expression levels, particularly addressing the high AT content characteristic of Campylobacter genes.

When expressing the full-length lspA, inclusion of a C-terminal fusion partner such as GFP can provide a convenient way to monitor expression and proper folding.

What purification strategy yields active recombinant lspA while maintaining its native conformation?

Purification of recombinant C. jejuni subsp. doylei lspA requires careful attention to maintaining the native conformation of this membrane protein. The following multi-step strategy has proven effective for similar membrane proteins:

  • Membrane extraction:

    • Harvest cells and disrupt by sonication or high-pressure homogenization

    • Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membranes with high-salt buffer (300 mM NaCl) to remove peripheral proteins

  • Solubilization:

    • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% w/v

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation

  • Immobilized metal affinity chromatography (IMAC):

    • Apply solubilized material to Ni-NTA resin

    • Wash with buffer containing 25-30 mM imidazole to reduce non-specific binding

    • Elute with 250-300 mM imidazole

    • Throughout IMAC, maintain 0.05% DDM in all buffers

  • Size exclusion chromatography:

    • Further purify using a Superdex 200 column

    • Running buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDM, 5% glycerol

  • Activity preservation measures:

    • Include 1 mM DTT in all buffers to maintain cysteine residues in reduced state

    • Add 10 μM ZnSO4 to buffers to ensure metal cofactor availability

    • Store purified protein at -80°C in small aliquots with 20% glycerol

This protocol has successfully maintained enzymatic activity in similar membrane-bound peptidases and would be expected to preserve lspA functionality.

How can researchers troubleshoot low expression yields of recombinant Cjd lspA?

Low expression yields of recombinant C. jejuni subsp. doylei lspA can be addressed through a systematic troubleshooting approach:

  • Toxicity assessment:

    • Monitor growth curves after induction

    • If severe growth arrest occurs, reduce inducer concentration or use more tightly regulated promoters like pBAD

    • Consider testing Lemo21(DE3) strain, which allows tunable expression levels

  • Protein stability enhancement:

    • Co-express molecular chaperones (GroEL/ES, DnaK/J/GrpE)

    • Add stabilizing ligands to the growth medium if known

    • Include membrane-stabilizing agents such as specific lipids or cholesterol

  • Codon optimization strategies:

    • Analyze the Cjd lspA sequence for rare codons in E. coli

    • Generate a codon-optimized synthetic gene

    • Alternatively, co-express rare tRNA genes using plasmids like pRARE

  • Fusion tag optimization:

    • Test N-terminal fusions with MBP or SUMO to enhance solubility

    • Consider dual fusion systems with different tags at each terminus

    • Evaluate the impact of tag position on membrane insertion and folding

  • Alternative expression platforms:

    • Cell-free protein synthesis systems with supplied detergents or nanodiscs

    • Yeast expression systems like Pichia pastoris

    • Pseudomonas-based expression systems, which may be more compatible with Campylobacter proteins

The systematic application of these strategies, potentially in combination, can significantly improve recombinant Cjd lspA expression yields for structural and functional studies.

What methods are most reliable for assessing the enzymatic activity of purified recombinant lspA?

Several complementary methods can be employed to reliably assess the enzymatic activity of purified recombinant C. jejuni subsp. doylei lspA:

  • Fluorogenic peptide substrate assay:

    • Design peptides containing the C. jejuni lipobox sequence coupled to a fluorophore/quencher pair

    • Upon cleavage by lspA, fluorescence increases as the quencher is separated from the fluorophore

    • Monitor reaction kinetics in real-time using a fluorescence plate reader

    • Assay buffer: 50 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDM, 10 μM ZnSO4

  • Mass spectrometry-based assay:

    • Incubate lspA with synthetic prolipoprotein peptides

    • Analyze reaction products by MALDI-TOF or LC-MS/MS

    • Identify specific cleavage sites and reaction intermediates

    • Calculate enzyme kinetics by quantifying substrate disappearance and product formation over time

  • In vitro processing of native C. jejuni prolipoproteins:

    • Express and purify selected C. jejuni prolipoproteins

    • Incubate with purified lspA under various conditions

    • Analyze by SDS-PAGE to detect mobility shift upon signal peptide cleavage

    • Confirm processing by N-terminal sequencing or mass spectrometry

  • Inhibitor-based validation:

    • Test activity in the presence of known lspA inhibitors like globomycin

    • Establish dose-response curves and calculate IC50 values

    • Perform site-directed mutagenesis of predicted catalytic residues and demonstrate loss of activity

These methods allow for comprehensive characterization of enzyme activity, substrate specificity, and inhibitor sensitivity, providing valuable insights into the functional properties of Cjd lspA.

What structural techniques are most promising for elucidating the three-dimensional structure of Cjd lspA?

Determining the three-dimensional structure of C. jejuni subsp. doylei lspA presents challenges typical of membrane proteins. The following techniques offer promising approaches:

  • X-ray crystallography with membrane protein-specific optimizations:

    • Lipidic cubic phase (LCP) crystallization, which maintains membrane proteins in a lipid bilayer-like environment

    • Addition of crystallization chaperones such as nanobodies or Fab fragments

    • Fusion with crystallization-promoting proteins (e.g., T4 lysozyme, BRIL)

    • Extensive detergent and lipid screening to identify optimal crystallization conditions

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for larger constructs or complexes

    • Use of scaffold proteins or amphipols to increase particle size

    • Implementation of advanced image processing techniques to address preferred orientation issues

    • Potentially suitable for capturing different conformational states

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR with detergent-solubilized protein for dynamic studies

    • Solid-state NMR for structure in a more native-like lipid environment

    • Selective isotopic labeling strategies to simplify spectra

    • Focus on specific domains or functional regions if the full protein proves challenging

  • Hybrid approaches:

    • Integrative structural biology combining low-resolution methods with computational modeling

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map flexible regions and ligand binding sites

    • Cross-linking mass spectrometry (XL-MS) to provide distance constraints

    • Homology modeling based on structures of lspA from other bacterial species

The successful determination of C. jejuni LptE (Cj1090c) structure at 2.4 Å resolution suggests that with appropriate optimization, high-resolution structural studies of Cjd lspA are feasible.

How does the substrate specificity of Cjd lspA compare with homologs from other bacteria?

The substrate specificity of C. jejuni subsp. doylei lspA likely shows both conserved features and subspecies-specific adaptations compared to homologs from other bacteria:

  • Conserved lipobox recognition:

    • Like all bacterial lspA enzymes, Cjd lspA would recognize the canonical lipobox motif [LVI][ASTVI][GAS][C]

    • The catalytic mechanism involving zinc coordination by conserved aspartate residues is likely preserved

    • Core structural features of the active site that accommodate the lipobox would be maintained

  • Subspecies-specific adaptations:

    • The distinct pathogenic profile of Cjd suggests potential adaptations in substrate recognition

    • Given the reduced set of lipoproteins in Cjd compared to Cjj (as implied by genome analysis ), lspA may show altered specificity reflecting this reduced substrate pool

    • Variations in residues surrounding the active site might tune specificity for the particular lipoproteins expressed by Cjd

  • Comparative substrate preference profile:

    • Systematic analysis using peptide libraries representing lipoboxes from different bacterial species

    • Expected preferences for positions -3, -2, and -1 relative to the conserved cysteine

    • Potential influence of residues beyond the canonical lipobox

  • Evolutionary considerations:

    • Phylogenetic analysis placing Cjd lspA in the context of other Campylobacter species

    • Identification of subspecies-specific variations that might correlate with host adaptation

    • Assessment of selective pressure on different regions of the enzyme

Understanding these specificity differences could provide insights into the evolutionary adaptations of Cjd and potentially identify unique features that could be exploited for subspecies-specific targeting.

What approaches are most effective for studying lspA gene expression regulation in Cjd?

To effectively study lspA gene expression regulation in C. jejuni subsp. doylei, researchers should consider the following comprehensive approaches:

  • Transcriptional analysis:

    • Quantitative RT-PCR to measure lspA mRNA levels under various conditions

    • RNA-Seq to place lspA expression in the context of the global transcriptome

    • 5' RACE to precisely map transcription start sites and identify promoter regions

    • Northern blotting to determine if lspA is part of an operon structure

  • Promoter characterization:

    • Reporter gene fusions (e.g., lspA promoter-lacZ) to quantify promoter activity

    • Site-directed mutagenesis of putative regulatory elements

    • Electrophoretic mobility shift assays (EMSA) to identify DNA-binding proteins

    • DNase I footprinting to precisely map protein-binding sites

  • Environmental and stress response assessment:

    • Expression analysis under conditions mimicking host environments (bile salts, oxygen limitation, etc.)

    • Response to membrane stress inducers that might trigger envelope stress responses

    • Temperature-dependent regulation (37°C vs. 42°C), given the variable growth of Cjd at higher temperatures

    • Nutrient limitation studies

  • Regulatory network mapping:

    • Construction of isogenic mutants in potential regulatory genes

    • Chromatin immunoprecipitation (ChIP) to identify regulatory proteins binding to the lspA promoter

    • Two-hybrid screening to identify protein-protein interactions with regulatory factors

    • Comparative genomics to identify conserved regulatory motifs

These approaches would provide comprehensive insights into how Cjd regulates lspA expression in response to environmental conditions, potentially revealing subspecies-specific regulatory mechanisms related to its unique pathogenic profile.

How can comparative genomics of lspA across Campylobacter species inform evolutionary adaptations?

Comparative genomics of lspA across Campylobacter species can reveal important evolutionary adaptations through several analytical approaches:

  • Sequence conservation analysis:

    • Multiple sequence alignment of lspA coding sequences from diverse Campylobacter isolates

    • Calculation of conservation scores for each amino acid position

    • Identification of subspecies-specific variations, particularly in C. jejuni subsp. doylei

    • Mapping conservation patterns onto structural models to identify functionally important regions

  • Selective pressure analysis:

    • Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates) across the gene

    • Identification of codons under positive selection that might indicate adaptive evolution

    • Comparison of selection patterns between functional domains

    • Correlation of selection hotspots with pathogenicity differences between subspecies

  • Genomic context examination:

    • Analysis of the genetic neighborhood surrounding lspA across species

    • Identification of conserved operonic structures or gene clusters

    • Detection of horizontally transferred genomic islands that might include lspA

    • Comparison with the genomic organization observed in multilocus sequence typing studies of Cjd strains

  • Phylogenetic analysis:

    • Construction of lspA gene trees and comparison with species trees

    • Identification of potential recombination events

    • Correlation with geographic distribution and host association patterns

    • Integration with MLST data, which has already demonstrated the distinct phylogenetic position of Cjd strains

This comparative approach could reveal how lspA has evolved to support the unique pathogenic characteristics of C. jejuni subsp. doylei, including its association with bacteremia and pediatric infections .

What would be the predicted phenotype of an lspA knockout in Cjd compared to Cjj?

Predicting the phenotype of an lspA knockout in C. jejuni subsp. doylei compared to C. jejuni subsp. jejuni requires consideration of their distinct genomic and physiological characteristics:

  • Viability and growth:

    • Both subspecies would likely show severe growth defects or complete non-viability since lspA is typically essential in Gram-negative bacteria

    • Cjd might show more pronounced growth defects due to its already restricted metabolic capabilities compared to Cjj

    • If viable, conditional knockdowns would reveal more subtle growth phenotypes

  • Membrane integrity and stress response:

    • Both would exhibit compromised outer membrane integrity

    • Increased sensitivity to detergents, antimicrobial peptides, and antibiotics

    • Cjd might show distinctive stress response patterns reflecting its different environmental adaptations and reduced metabolic repertoire

  • Virulence factor expression:

    • Altered surface presentation of lipidated virulence factors

    • Cjd-specific effects on bacteremia-associated virulence traits, given its higher association with bloodstream infections

    • Differential impact on host immune recognition patterns

  • Host interaction differences:

    • Both would likely show reduced colonization ability in animal models

    • Cjd might exhibit unique defects in traits related to its pediatric patient association

    • Potentially differential effects on adhesion, invasion, and intracellular survival

  • Compensatory mechanisms:

    • Possible differential activation of alternative protein secretion/localization pathways

    • Strain-specific transcriptional responses to membrane stress

    • Varying capacities to upregulate alternate virulence mechanisms

These predicted phenotypic differences would reflect the genomic divergence between Cjd and Cjj strains observed in multilocus sequence typing and comparative genomic indexing studies .

How can structural information about Cjd lspA be leveraged for antimicrobial development?

Structural information about C. jejuni subsp. doylei lspA offers significant opportunities for antimicrobial development through several strategic approaches:

  • Structure-based inhibitor design:

    • Identification of the catalytic site architecture and critical residues

    • Virtual screening of compound libraries against the active site

    • Fragment-based drug discovery to identify chemical scaffolds that bind to specific pockets

    • Structure-activity relationship studies to optimize lead compounds

  • Allosteric inhibitor development:

    • Mapping of potential allosteric sites that could modulate enzyme activity

    • Molecular dynamics simulations to identify conformational changes during catalysis

    • Design of compounds that lock the enzyme in inactive conformations

    • Exploitation of subspecies-specific structural features for selective targeting

  • Rational modification of known lspA inhibitors:

    • Optimization of existing inhibitors like globomycin based on Cjd lspA structure

    • Improvement of pharmacokinetic properties while maintaining antimicrobial activity

    • Development of peptidomimetics that resemble the lipobox but resist cleavage

    • Structure-guided approaches to overcome potential resistance mechanisms

  • Protein-protein interaction disruption:

    • Identification of interactions between lspA and other components of the lipoprotein processing machinery

    • Design of peptidomimetics or small molecules that disrupt these interactions

    • Targeting of subspecies-specific interaction interfaces

The clinical significance of C. jejuni subsp. doylei, particularly its association with bacteremia in pediatric patients , makes it an important target for novel antimicrobial development. Structural insights from lspA could lead to therapeutics with activity against this challenging pathogen.

What are the methodological considerations for evaluating lspA inhibitors against Cjd in research settings?

Evaluating lspA inhibitors against C. jejuni subsp. doylei in research settings requires careful methodological considerations to ensure reliable and translatable results:

  • In vitro enzymatic assays:

    • Development of high-throughput screening assays using purified recombinant Cjd lspA

    • Determination of inhibition constants (Ki) and mechanism of inhibition

    • Assessment of time-dependent inhibition and reversibility

    • Comparative testing against lspA from other bacterial species to evaluate specificity

  • Microbiology-based evaluation:

    • Determination of minimum inhibitory concentrations (MICs) against a panel of geographically diverse Cjd clinical isolates

    • Time-kill kinetics to assess bactericidal vs. bacteriostatic activity

    • Biofilm inhibition assays to evaluate activity against sessile populations

    • Selection for resistant mutants and characterization of resistance mechanisms

  • Mechanism of action confirmation:

    • Accumulation of prolipoproteins as detected by western blotting

    • Lipidomic analysis to detect changes in lipid-modified proteins

    • Proteomic analysis to confirm effects on the lipoprotein profile

    • Transcriptomic analysis to identify compensatory responses

  • Host-pathogen interaction models:

    • Epithelial cell infection models to assess effects on adhesion and invasion

    • Macrophage survival assays to evaluate intracellular persistence

    • Serum resistance testing, particularly relevant given Cjd's association with bacteremia

    • Animal models appropriate for Cjd infections, with careful consideration of ethical aspects

  • Combination therapy assessment:

    • Checkerboard assays to evaluate synergy with existing antibiotics

    • Testing under conditions mimicking in vivo environments

    • Effect on emergence of resistance to companion antibiotics

These methodological considerations would ensure robust evaluation of lspA inhibitors against Cjd while addressing the unique challenges posed by this subspecies.

How might lspA-processed lipoproteins in Cjd be exploited for vaccine development?

The lspA-processed lipoproteins in C. jejuni subsp. doylei present several promising avenues for vaccine development:

  • Subunit vaccine candidates:

    • Identification of surface-exposed lipoproteins unique to or conserved in Cjd

    • Recombinant expression of mature lipoproteins without their signal sequences

    • Evaluation of immunogenicity in animal models

    • Assessment of cross-protection against diverse Cjd strains

  • Lipidation-based adjuvant strategies:

    • Utilization of the TLR2-stimulating properties of bacterial lipoproteins

    • Design of fusion constructs linking Cjd antigens to lipoprotein sequences

    • Optimization of lipid moieties to enhance immune stimulation

    • Balancing pro-inflammatory responses with protective immunity

  • Reverse vaccinology approach:

    • In silico analysis of the Cjd genome to identify all potential lipoproteins

    • Prioritization based on predicted surface exposure, conservation, and absence in commensal bacteria

    • High-throughput screening for immunogenicity and protective capacity

    • Combination of multiple lipoprotein antigens for broader protection

  • Attenuated live vaccine development:

    • Construction of Cjd strains with attenuated lspA activity or modified lipoprotein processing

    • Development of strains that express immunogenic lipoproteins but have reduced virulence

    • Evaluation of colonization, immune response, and protection in animal models

    • Assessment of safety in the context of Cjd's association with bacteremia

  • Targeted liposome-based delivery:

    • Incorporation of key Cjd lipoproteins into liposomal formulations

    • Design of delivery systems mimicking bacterial outer membrane vesicles

    • Addition of appropriate adjuvants to enhance immunogenicity

    • Evaluation of mucosal delivery routes relevant to Campylobacter infection

The distinctive clinical profile of Cjd infections, particularly their association with bacteremia and pediatric patients , underscores the importance of developing effective vaccines against this subspecies.

How can CRISPR-Cas9 genome editing be optimized for studying lspA function in Cjd?

Optimizing CRISPR-Cas9 genome editing for studying lspA function in C. jejuni subsp. doylei requires addressing several technical challenges specific to this organism:

  • Delivery system optimization:

    • Development of transformation protocols specific for Cjd strains, which may have different efficiency compared to Cjj

    • Utilization of electroporation parameters optimized for Cjd's membrane characteristics

    • Evaluation of conjugation-based delivery systems if transformation efficiency is low

    • Construction of shuttle vectors with appropriate selection markers for Cjd

  • CRISPR component adaptation:

    • Codon optimization of Cas9 for expression in Campylobacter

    • Selection of promoters active in Cjd for Cas9 and guide RNA expression

    • Temperature-controlled expression systems given Cjd's variable growth at higher temperatures

    • Design of inducible systems to control Cas9 expression timing

  • Guide RNA design strategies:

    • Thorough analysis of the Cjd genome for potential off-target sites

    • Selection of target sites that minimize off-target effects

    • Design of guides targeting non-essential regions of lspA for partial function studies

    • Implementation of multiplexed guide RNA approaches for more complex genetic manipulations

  • Homology-directed repair optimization:

    • Design of repair templates with extended homology arms (>1 kb) to enhance recombination efficiency

    • Introduction of silent mutations in PAM sites or seed regions to prevent re-cutting

    • Inclusion of selectable markers for positive selection of edited cells

    • Development of scarless editing strategies for physiologically relevant studies

  • Conditional systems for essential gene studies:

    • Creation of CRISPRi systems for transcriptional repression rather than gene knockout

    • Development of degron-based systems for controllable protein degradation

    • Construction of complementation systems with inducible or repressible promoters

    • Design of partial deletions or domain-specific mutations that maintain essential functions

These optimized CRISPR-Cas9 approaches would enable precise genetic manipulation of lspA in Cjd, facilitating detailed functional studies while addressing the challenges posed by this clinically significant subspecies.

What advanced structural biology techniques could reveal the conformational dynamics of lspA during catalysis?

Understanding the conformational dynamics of lspA during catalysis requires cutting-edge structural biology techniques that can capture transient states and molecular movements:

  • Time-resolved X-ray crystallography:

    • Utilization of X-ray free-electron lasers (XFELs) for ultrafast diffraction experiments

    • Design of photocaged substrates or inhibitors for synchronized reaction initiation

    • Capture of structural snapshots at multiple time points during catalysis

    • Correlation of structural changes with reaction intermediates

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of regions with changing solvent accessibility during substrate binding and catalysis

    • Time-resolved experiments to follow conformational changes

    • Comparative analysis of wild-type lspA versus catalytic mutants

    • Identification of allosteric networks connecting substrate binding to catalytic sites

  • Advanced nuclear magnetic resonance (NMR) techniques:

    • Relaxation dispersion experiments to detect millisecond timescale motions

    • Selective isotopic labeling to monitor specific regions during catalysis

    • Paramagnetic relaxation enhancement to measure distances between domains

    • Solid-state NMR in native-like lipid environments to capture membrane-associated dynamics

  • Single-molecule Förster resonance energy transfer (smFRET):

    • Strategic placement of fluorophore pairs to monitor domain movements

    • Real-time observation of individual enzyme molecules during catalysis

    • Detection of conformational heterogeneity in the enzyme population

    • Correlation of conformational states with catalytic events

  • Molecular dynamics simulations:

    • All-atom simulations of lspA in explicit membrane environments

    • Enhanced sampling techniques to access longer timescales relevant to catalysis

    • Integration with experimental data for validation and refinement

    • Computational enzyme design to test hypotheses about catalytic mechanism

These advanced techniques would provide unprecedented insights into how lspA undergoes conformational changes during substrate binding, catalysis, and product release, potentially revealing subspecies-specific features of the C. jejuni subsp. doylei enzyme.

How can systems biology approaches integrate lspA function into the broader context of Cjd pathogenesis?

Systems biology approaches can effectively integrate lspA function into the broader context of C. jejuni subsp. doylei pathogenesis through several sophisticated strategies:

  • Multi-omics integration:

    • Correlation of transcriptomics, proteomics, and lipidomics data to map the impact of lspA activity

    • Identification of regulatory networks connecting lspA expression to virulence factor production

    • Temporal profiling during infection to reveal stage-specific roles of lipoprotein processing

    • Comparative multi-omics between Cjd and Cjj to identify subspecies-specific patterns

  • Network analysis:

    • Construction of protein-protein interaction networks centered on lspA and processed lipoproteins

    • Pathway enrichment analysis to identify biological processes dependent on lipoprotein processing

    • Identification of hub proteins that connect lipoprotein processing to other cellular functions

    • Differential network analysis between wild-type and lspA-modulated strains

  • Host-pathogen interaction modeling:

    • Integration of bacterial and host transcriptomics during infection

    • Modeling of immune response networks triggered by lspA-processed lipoproteins

    • Prediction of host factors that interact with specific bacterial lipoproteins

    • Simulation of infection dynamics with varying levels of lspA activity

  • Genome-scale metabolic modeling:

    • Integration of lipoprotein functions into metabolic models of Cjd

    • Prediction of metabolic adaptations in response to lipoprotein processing defects

    • Identification of condition-specific roles of lipoproteins in nutrient acquisition

    • Comparative analysis with Cjj models to highlight metabolic differences

  • Evolutionary systems biology:

    • Analysis of lspA and lipoprotein co-evolution across Campylobacter species

    • Identification of lipoproteins under similar selective pressures as lspA

    • Correlation of evolutionary patterns with pathogenic traits specific to Cjd

    • Integration with population genomics data to connect lipoprotein processing to host adaptation

These systems approaches would provide a comprehensive understanding of how lspA and its processed lipoproteins contribute to the unique pathogenic profile of C. jejuni subsp. doylei, including its association with bacteremia and pediatric infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.