Recombinant Campylobacter jejuni subsp. doylei Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Campylobacter jejuni subsp. doylei Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Campylobacter jejuni subsp. doylei Prolipoprotein diacylglyceryl transferase (lgt) is a bacterial enzyme critical for lipid modification of lipoproteins, a process essential for membrane biogenesis and virulence. The lgt enzyme catalyzes the transfer of a diacylglyceryl group to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, enabling their anchoring to the cell membrane . This enzyme is of particular interest in studying Campylobacter pathogenesis and developing diagnostic or therapeutic tools .

Protein Characteristics

The recombinant lgt from C. jejuni subsp. doylei (strain ATCC BAA-1458/RM4099) is a 271-amino acid protein with a molecular weight of ~31 kDa . Key features include:

PropertyDetail
Uniprot IDA7H4X1
Gene LocusJJD26997_1550
Expression SystemEscherichia coli
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C
Enzyme ActivityConfirmed via complementation assays in E. coli lgt-depletion strains

Catalytic Mechanism

lgt belongs to the family of membrane-bound transferases, featuring seven transmembrane domains with the N-terminus periplasmic and C-terminus cytoplasmic . Critical residues for activity include Y26, N146, G154, R143, E151, R239, and E243, identified through alanine substitution studies . The enzyme’s signature motif is conserved across Gram-negative and Gram-positive bacteria .

Diagnostic and Vaccine Development

Recombinant lgt is used in ELISA-based assays to study immune responses to Campylobacter infections . Its role in lipopolysaccharide (LOS) biosynthesis makes it a target for vaccine development, as LOS diversity correlates with virulence and host adaptation .

Functional Studies

  • LOS Biosynthesis: Mutations in lgt disrupt outer core oligosaccharide synthesis, leading to truncated LOS structures (e.g., loss of β-1,4-glucose and β-1,2-glucose residues) .

  • Host Adaptation: Comparative genomics shows C. jejuni subsp. doylei lacks metabolic and virulence genes present in subsp. jejuni, suggesting niche-specific evolution .

Genetic Divergence

C. jejuni subsp. doylei exhibits distinct genomic features compared to subsp. jejuni:

  • Absence of cytolethal distending toxin (CDT) and nitrate reductase genes .

  • Phylogenetic separation confirmed by multilocus sequence typing (MLST) and comparative genomic indexing .

Evolutionary Dynamics

  • Lateral Gene Transfer (LGT): Frequent LGT within Campylobacter species drives LOS/CPS diversity, enabling evasion of host defenses .

  • Host Specificity: C. jejuni subsp. doylei is primarily isolated from human bacteremia cases, unlike subsp. jejuni, which colonizes poultry .

Epidemiological Significance

  • Clinical Association: Subsp. doylei is linked to pediatric bacteremia and gastroenteritis, with unique virulence adaptations .

  • Diagnostic Markers: Recombinant lgt aids in distinguishing subsp. doylei infections from other Campylobacter species .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please specify this in your order; we will prioritize fulfilling your request.
Synonyms
lgt; JJD26997_1550; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Target Names
lgt
Target Protein Sequence
MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYDVALLLALLLAKFFVRKFQLDINEKHLYSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYIDGVLRH PSQFYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in mature lipoprotein formation.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni subsp. doylei and how does it differ from other Campylobacter subspecies?

Campylobacter jejuni subsp. doylei (Cjd) is one of two subspecies of C. jejuni, the other being C. jejuni subsp. jejuni (Cjj). Unlike Cjj, which is commonly isolated from avian hosts and clinical samples, Cjd is isolated infrequently and primarily from human clinical specimens. The key distinguishing characteristic of Cjd is its inability to reduce nitrate, which is the basis for its classification as a separate subspecies .

Other distinguishing features of Cjd include:

  • Variable growth at 42°C (generally poor compared to Cjj)

  • High susceptibility to cephalothin antibiotics

  • Absence of γ-glutamyl transferase (GGT) activity

  • Absence of L-arginine arylamidase activity

  • Association with both gastroenteritis and bacteremia in clinical settings

Cjd has a unique clinical significance in that it is isolated more frequently from blood cultures than stool cultures in certain regions. For example, in South Africa, Cjd represented 24% of Campylobacter-positive blood cultures compared to only 7.7% of stool cultures at the Red Cross Children's Hospital in Cape Town during 1990-2005 .

What is the function of prolipoprotein diacylglyceryl transferase (lgt) in bacterial cells?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in bacterial lipoprotein biogenesis that catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox sequence of prolipoproteins . This reaction represents the first step in bacterial lipoprotein processing, which is followed by signal peptide cleavage and, in some bacteria, further acylation.

The function of lgt is critical because:

  • It initiates the membrane anchoring of lipoproteins

  • It enables proper localization of numerous proteins involved in nutrient acquisition, cell wall maintenance, antibiotic resistance, and virulence

  • It is essential for bacterial viability in many species

  • It represents a potential target for antimicrobial development as the pathway does not exist in eukaryotes

How do genetic differences between C. jejuni subspecies impact the structure and function of lgt?

While the search results don't specifically address genetic variations in lgt between C. jejuni subspecies, we can infer potential impacts based on known genetic differences between Cjj and Cjd. Cjd strains contain distinctive genomic deletions, particularly in the nitrate reductase (nap) locus, with all Cjd strains tested having identical 2761 bp deletions in napA and several strains containing deletions in napB .

These subspecies-specific genetic variations suggest that other genes, potentially including lgt, might also exhibit structural and functional differences. Such variations could impact:

  • Enzyme kinetics and substrate specificity

  • Thermal stability (relevant given the different growth temperature optima of the subspecies)

  • Interaction with other proteins in the lipoprotein biosynthetic pathway

  • Recognition of substrate prolipoproteins

These differences would be particularly important to consider when developing recombinant expression systems for Cjd lgt, as expression conditions may need to be optimized differently compared to Cjj lgt.

What are the optimal conditions for expressing recombinant C. jejuni subsp. doylei lgt in heterologous systems?

Based on bacterial protein expression principles and the unique characteristics of Cjd, several factors should be considered when expressing recombinant Cjd lgt:

Expression System Selection:

  • E. coli systems typically provide high yields but may not support proper folding of membrane proteins

  • Alternative hosts like Lactococcus lactis or cell-free systems might be more suitable for maintaining native conformation

Temperature Considerations:

  • Cjd grows optimally at 37°C rather than 42°C (unlike Cjj)

  • Expression at 30°C may enhance solubility while maintaining activity

  • Avoid expression at 42°C as this would not reflect the native thermal environment of Cjd

Purification Strategy:

  • Membrane-bound nature of lgt necessitates careful detergent selection

  • Commonly used detergents for membrane protein purification:

DetergentCritical Micelle ConcentrationAdvantagesLimitations
DDM0.17 mMMild, preserves activityLarge micelles
LDAO1-2 mMSmall micelles, good for crystallizationCan be denaturing
Digitonin0.5 mMVery mild, good for complexesExpensive, UV-absorbing

Codon Optimization:
Consider codon optimization for the expression host, particularly as Campylobacter has a different GC content compared to common expression hosts like E. coli.

How does the substrate specificity of C. jejuni subsp. doylei lgt compare with that of other bacterial species?

This question requires experimental determination, but based on comparative analysis principles, we can outline the approach to address it:

Methodological Approach:

  • Express and purify recombinant lgt from Cjd and comparative species (e.g., E. coli, Cjj)

  • Develop an in vitro assay measuring transfer of radiolabeled or fluorescently-tagged phospholipids to synthetic prolipoprotein substrates

  • Compare kinetic parameters (Km, kcat, kcat/Km) for various substrate combinations

Expected Substrate Specificity Considerations:

  • Phospholipid donor preferences (phosphatidylglycerol, phosphatidylethanolamine)

  • Lipobox sequence recognition (variations in the consensus sequence)

  • Influence of surrounding amino acids in the prolipoprotein

Similar enzymes like Cj1294 (a pyridoxal phosphate-dependent aminotransferase in C. jejuni) have been characterized with Km values of 1.28 ± 0.2 mM and kcat of 11.5 ± 1.3 min−1 . While lgt would have different parameters, this example demonstrates the kind of kinetic data that would be valuable for comparative analysis of Cjd lgt.

What role does horizontal gene transfer play in the evolution of lgt in C. jejuni subspecies?

Horizontal gene transfer (HGT) represents a significant evolutionary force in Campylobacter species. Research on Campylobacter genomes has revealed that:

  • Recombination is particularly strong within Campylobacter, leading to the emergence of new lineages

  • Genome-wide interspecies introgression has been documented between C. jejuni and C. coli

  • Recombination within the core genome is frequent within species, rare between sister species, and extremely rare with other species

For lgt specifically, its essential nature suggests it would be part of the core genome. Analysis methods to determine if HGT has influenced lgt evolution would include:

  • Phylogenetic analysis comparing lgt gene trees with species trees

  • Analysis of GC content and codon usage patterns in lgt versus genome averages

  • Examination of flanking mobile genetic elements

  • Calculation of dN/dS ratios to determine selective pressures

The dispensable genome components show considerable overlap in intra- and interspecies divergence, while core genes display little divergence overlap . If lgt exhibits unusual patterns of sequence diversity compared to other core genes, this could indicate HGT events.

What are the most effective molecular methods for identifying and characterizing C. jejuni subsp. doylei strains for lgt studies?

PCR-Based Subspeciation:
The nitrate reductase (nap) locus provides an excellent target for distinguishing Cjd from Cjj strains. Two multiplex PCR methods have been developed:

  • nap mpx1: Uses internal and flanking napA and napB primer sets

  • nap mpx2: An alternative multiplex primer set targeting the same locus

Both methods can unambiguously differentiate Cjd from Cjj strains. These can be combined with lpxA speciation multiplex methods for simultaneous speciation and subspeciation of thermophilic Campylobacters .

Biochemical Identification:
Several biochemical tests can complement molecular identification:

  • Nitrate reduction test (negative for Cjd)

  • Growth at 42°C (variable for Cjd, positive for Cjj)

  • Cephalothin susceptibility (high in Cjd)

  • γ-glutamyl transferase activity test (absent in Cjd)

Isolation Considerations:
Standard isolation protocols may miss Cjd strains due to:

  • Use of 42°C incubation (Cjd grows better at 37°C)

  • Inclusion of antibiotics that inhibit Cjd growth

  • Lack of subspecies identification in routine diagnostics

The Cape Town Protocol, which uses passive filtration through a 0.65 μM membrane filter, growth at 37°C, and no antibiotic selection, has been successful for Cjd isolation .

How can structural analysis techniques be applied to understand the mechanism of Cjd lgt?

X-ray Crystallography Approach:

  • Express recombinant Cjd lgt with purification tags (His-tag or fusion proteins)

  • Optimize detergent conditions for membrane protein extraction and purification

  • Screen crystallization conditions using sparse matrix approaches

  • Collect diffraction data and solve structure using molecular replacement with existing bacterial lgt structures as models

Cryo-EM Alternative:
For challenging membrane proteins that resist crystallization:

  • Purify lgt in lipid nanodiscs or amphipols

  • Prepare grids with optimized protein concentration

  • Collect and process micrographs to generate 3D reconstructions

Site-Directed Mutagenesis Studies:
Based on structural models or alignments, identify key residues for:

  • Catalytic function

  • Substrate binding

  • Membrane association

For instance, studies on the Cj1294 enzyme identified two essential residues (Arg228 and Lys181) for protein stability and activity through site-directed mutagenesis . Similar approaches could identify key functional residues in Cjd lgt.

What in vitro assay systems can accurately measure the enzymatic activity of recombinant Cjd lgt?

Radioactive Assay:

  • Incubate purified lgt with [³H]-labeled phosphatidylglycerol and synthetic prolipoprotein substrate

  • Extract lipid-modified peptides using chloroform-methanol

  • Quantify incorporation by scintillation counting

Fluorescence-Based Assays:

  • Use environmentally sensitive fluorophores conjugated to substrate peptides

  • Monitor changes in fluorescence upon lipid modification

  • Advantages include real-time kinetics and avoidance of radioactivity

Mass Spectrometry Assay:

  • Incubate enzyme with substrates

  • Analyze reaction products by MALDI-TOF or LC-MS/MS

  • Identify modified peptides by mass shift

  • Quantify conversion rates using labeled internal standards

Comparative Assay Performance:

Assay TypeSensitivityThroughputEquipment CostAdvantagesLimitations
RadioactiveVery highLowModerateGold standard, quantitativeSafety concerns, waste disposal
FluorescenceHighHighHighReal-time kinetics, adaptable to HTSPotential fluorophore interference
Mass SpectrometryVery highModerateVery highDirect product identificationComplex data analysis, expensive

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.