Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP)

Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP) is a bacterially derived enzyme produced through recombinant DNA technology. This protein, encoded by the uppP gene (locus JJD26997_0215 in strain ATCC BAA-1458/RM4099/269.97), catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP), a critical step in bacterial cell wall biosynthesis . Its role in lipid carrier regeneration makes it a target for studying antibiotic resistance mechanisms, particularly bacitracin resistance .

Protein Features

  • UniProt ID: A7H1R9

  • EC Number: 3.6.1.27

  • Amino Acid Sequence: Partial sequence (residues 1–267) with predicted domains for phosphatase activity .

  • Expression Systems: Produced in E. coli, baculovirus, or mammalian cells .

Antibiotic Resistance Studies

uppP confers bacitracin resistance by recycling UP, a lipid carrier essential for peptidoglycan synthesis. Disruption of uppP activity sensitizes bacteria to bacitracin, highlighting its role as a drug target .

Pathogenicity and Vaccine Development

  • Host Interaction: uppP contributes to C. jejuni survival in host environments, including poultry reservoirs .

  • Recombinant Use: The protein is utilized in ELISA and immunoblot assays to study immune responses during Campylobacter infections .

Evolutionary and Genomic Context

  • Genetic Diversity: The uppP gene is conserved across C. jejuni strains but undergoes rapid evolution via recombination, as observed in C. jejuni subsp. doylei .

  • Horizontal Gene Transfer: Recombination rates in Campylobacter spp. are twice the mutation rate, facilitating interspecies gene flow (e.g., with C. coli) .

Practical Considerations for Use

  • Reconstitution: Lyophilized protein should be dissolved in sterile water to 0.1–1.0 mg/mL, with glycerol (5–50%) added for long-term stability .

  • Limitations: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C retain activity for ≤1 week .

Future Directions

Current research gaps include direct functional assays for uppP in C. jejuni subsp. doylei and structural studies to guide inhibitor design. The protein’s role in zoonotic transmission and antibiotic resistance warrants further exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
uppP; JJD26997_0215; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Target Names
uppP
Target Protein Sequence
MGNLYALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLSVGFFPTGVIGFFVAKYLNALFNGWVVVGMLIFGGVMFILIEFAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.