Recombinant Campylobacter jejuni subsp. doylei UPF0059 membrane protein JJD26997_0180 (JJD26997_0180)

What is the UPF0059 membrane protein JJD26997_0180 and what is its biological significance?

The UPF0059 membrane protein JJD26997_0180 is a membrane-associated protein from Campylobacter jejuni subspecies doylei (strain ATCC BAA-1458/RM4099/269.97). This protein belongs to the UPF0059 family of membrane proteins, which are widely distributed across bacterial species but remain functionally uncharacterized, hence the "UPF" (Uncharacterized Protein Family) designation .

The protein consists of 187 amino acids and has a unique sequence characterized by hydrophobic regions consistent with transmembrane domains. Its complete amino acid sequence is: MDFYSLIFLSCALGMDAFAVSLCKSFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGITFASFIASIDH WIAFILLLSIGLKMIKESLENENSNSAKQFGFKTMLALAIATSIDALAVGVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKILIEHLFFD .

While the specific function of this protein remains to be fully elucidated, membrane proteins in C. jejuni generally play crucial roles in various cellular processes including adhesion to host cells, transport of molecules across the membrane, and interaction with the host immune system . For instance, other membrane proteins in C. jejuni such as PorA (Major Outer Membrane Protein) are involved in ion transport and adhesion to intestinal mucosa .

How does UPF0059 membrane protein compare structurally to other characterized membrane proteins in C. jejuni?

Unlike the well-characterized PorA (MOMP) of C. jejuni, which exists in multiple conformational forms including a folded monomer (35 kDa), denatured monomer (45 kDa), and native trimer (120-140 kDa), the UPF0059 membrane protein is smaller, with its 187 amino acids corresponding to approximately 20 kDa .

PorA consists of 18 β-strands connected by short periplasmic turns and nine external loops, with the external loops being antigenically variable . In contrast, sequence analysis of UPF0059 membrane protein suggests it likely adopts a different structural organization with multiple transmembrane segments characteristic of integral membrane proteins.

While PorA has well-documented pore-forming activities and roles in adhesion, the UPF0059 membrane protein's function remains largely speculative based on its sequence characteristics. The amino acid composition of UPF0059 suggests multiple hydrophobic regions that likely span the membrane, interspersed with charged residues that may be involved in protein-protein interactions or substrate recognition .

What expression systems are suitable for producing recombinant UPF0059 membrane protein?

For the expression of recombinant UPF0059 membrane protein from C. jejuni, several expression systems have proven effective for similar membrane proteins:

• E. coli expression system: This is often the first choice due to its simplicity, rapid growth, and high protein yields. For membrane proteins like UPF0059, E. coli strains specifically engineered for membrane protein expression (such as C41/C43 or Lemo21) may be preferable .

• Yeast expression systems: Organisms like Saccharomyces cerevisiae or Pichia pastoris can provide a eukaryotic environment with proper protein folding machinery while maintaining relatively high yields .

• Baculovirus expression system: This insect cell-based system offers advantages for complex membrane proteins that require specific post-translational modifications or folding assistance .

• Mammalian cell expression systems: Though more complex and expensive, these systems may be necessary if specific mammalian-type modifications are required for proper folding or function .

The choice of expression tag (such as GST fusion as used with other C. jejuni membrane proteins) can significantly impact solubility and purification efficiency. For instance, GST-fusion proteins have been successfully used with PorA from C. jejuni .

What are the predicted functional roles of UPF0059 membrane protein in C. jejuni pathogenesis?

Based on comparative analysis with other bacterial membrane proteins and the pathogenesis mechanisms of C. jejuni, UPF0059 membrane protein may participate in several aspects of bacterial virulence:

• Adhesion and colonization: Like other membrane proteins in C. jejuni such as the major outer membrane protein (MOMP) and CadF (a 37-kDa fibronectin-binding protein), UPF0059 might be involved in adhesion to host cell membranes or extracellular matrix proteins, which is considered an essential primary event in pathogenesis .

• Membrane transport: The protein's predicted transmembrane domains suggest it may function as a transporter for ions, nutrients, or antimicrobial compounds, potentially contributing to bacterial survival in the host environment.

• Immune evasion: Bacterial membrane proteins often interact with the host immune system. The UPF0059 protein could potentially contribute to immune evasion strategies or modulation of host responses.

• Environmental sensing: The protein might participate in sensing environmental cues within the host, contributing to adaptive responses during infection.

Research addressing these potential functions would require experimental approaches including gene knockout studies, adhesion assays with host cells, transport studies, and immunological investigations similar to those employed for PorA and other membrane proteins .

How can researchers assess the immunogenic properties of UPF0059 membrane protein?

Investigating the immunogenic properties of UPF0059 membrane protein requires a systematic approach similar to that used for other C. jejuni antigens like PorA:

Methodology Table: Assessment of Immunogenic Properties

The recombinant protein should be tested in both native and denatured forms, as the conformational state significantly affects immunogenicity and protective efficacy, as demonstrated with MOMP from C. jejuni . A comprehensive immunogenicity assessment would involve both humoral (antibody) and cellular immune responses, as both contribute to protection against C. jejuni.

What experimental approaches can be used to identify interaction partners of UPF0059 membrane protein?

Identifying protein-protein interactions involving UPF0059 membrane protein requires specialized techniques suitable for membrane proteins:

• Crosslinking studies: Chemical crosslinkers can capture transient protein interactions in their native membrane environment before solubilization and identification by mass spectrometry.

• Pull-down assays: Using the recombinant UPF0059 protein as bait (similar to how GST-PorA fusion proteins have been used) , potential binding partners from bacterial or host cell lysates can be captured and identified.

• Bacterial two-hybrid systems: Modified two-hybrid systems designed for membrane proteins can identify potential interaction partners by screening libraries of C. jejuni proteins.

• Co-immunoprecipitation: Using antibodies against UPF0059 to precipitate the protein along with its binding partners from solubilized membrane preparations.

• Ligand-binding immunoblotting assays: Similar to the approach used for identifying the adhesion properties of MOMP and other C. jejuni outer membrane proteins to INT 407 cell membranes and fibronectin .

• Surface plasmon resonance: To characterize binding kinetics and affinities between UPF0059 and potential interacting partners identified through other methods.

When interpreting results, it's important to consider that membrane protein interactions can be affected by detergents used in solubilization, as observed with MOMP when isolated under native conditions versus in the presence of SDS .

What are the optimal conditions for purification and storage of recombinant UPF0059 membrane protein?

Purification and Storage Protocol:

• Extraction methods:

  • For natively folded protein: Extraction using mild detergents like n-dodecyl β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG)

  • For denatured protein: Stronger detergents such as Sarkosyl (N-lauroylsarcosine) at 1%, following protocols similar to those used for MOMP purification

• Purification strategies:

  • Affinity chromatography using tags (His-tag or GST-tag) as the primary purification step

  • Size exclusion chromatography to separate different oligomeric states and remove aggregates

  • Ion exchange chromatography as a polishing step

• Buffer optimization:

  • Maintaining pH between 7-8 (typically Tris-based buffer)

  • Including stabilizing agents such as glycerol (often at 50% for long-term storage)

  • Adding specific lipids or detergents to maintain native conformation

• Storage conditions:

  • Short-term (up to one week): 4°C in appropriate buffer

  • Long-term: -20°C or -80°C with cryoprotectants

  • Avoiding repeated freeze-thaw cycles as they can lead to protein denaturation and aggregation

• Quality control checks:

  • SDS-PAGE to verify purity

  • Circular dichroism to assess secondary structure

  • Dynamic light scattering to check for aggregation

  • Functional assays where possible

It's worth noting that membrane proteins like UPF0059 often require customized conditions, and optimization may be necessary for each specific application.

How can researchers verify the structural integrity of purified recombinant UPF0059 membrane protein?

Verifying the structural integrity of membrane proteins is critical for functional studies and requires multiple complementary techniques:

The importance of structural integrity assessment is highlighted by studies of other C. jejuni membrane proteins like MOMP, where the protein isolated under native conditions retained partial ability to inhibit bacterial attachment to INT 407 cell membranes, while this ability was completely lost when the protein was isolated in the presence of SDS .

What controls should be included in immunological experiments using recombinant UPF0059 membrane protein?

Control Table for Immunological Experiments:

When conducting animal immunization studies, it's important to include controls similar to those used in studies of PorA, where mice given phosphate-buffered saline served as controls to assess the protective efficacy of the vaccine against heterologous strains .

What are the key considerations for designing experiments to determine the function of UPF0059 membrane protein?

Designing experiments to elucidate the function of uncharacterized membrane proteins requires a multi-faceted approach:

• Genomic context analysis:

  • Examine neighboring genes for functional clues

  • Identify conserved gene clusters across bacterial species

  • Analyze regulation patterns and promoter regions

• Sequence-based predictions:

  • Identify conserved domains and motifs

  • Conduct hydropathy analysis to predict transmembrane regions

  • Perform homology modeling if structural templates exist

• Gene knockout/knockdown studies:

  • Generate UPF0059 deletion mutants in C. jejuni

  • Assess phenotypic changes in growth, stress response, and virulence

  • Conduct complementation studies to confirm genotype-phenotype relationships

• Protein localization:

  • Confirm membrane localization using fractionation techniques

  • Determine topology using reporter fusions or accessibility assays

  • Assess distribution patterns during different growth phases

• Interaction studies:

  • Identify binding partners using techniques described in section 2.3

  • Characterize protein-lipid interactions

  • Test interactions with host cell components

• Functional assays based on predictions:

  • If transport function is suspected, conduct uptake assays with various substrates

  • For potential adhesins, perform adhesion assays to host cells or ECM components

  • Test involvement in stress response through challenge experiments

• Structural studies:

  • Attempt crystallization for X-ray crystallography

  • Consider cryo-EM for structural determination

  • Use NMR for dynamic studies of smaller fragments

Similar approaches have been successfully employed with other C. jejuni membrane proteins, such as the investigation of MOMP and CadF in adhesion to INT 407 cell membranes and fibronectin .

How might UPF0059 membrane protein contribute to vaccine development strategies against C. jejuni?

Based on experiences with other C. jejuni membrane proteins, particularly PorA (MOMP), the UPF0059 membrane protein has several potential applications in vaccine development:

• As a vaccine antigen: If sufficiently immunogenic and conserved across strains, UPF0059 could serve as a component in subunit vaccines. Research with PorA has demonstrated that recombinant membrane proteins from C. jejuni can provide appreciable protection (29-43%) against colonization with heterologous serotypes when delivered with appropriate adjuvants .

• As an adjuvant carrier: The protein could potentially be used as a carrier for poorly immunogenic antigens or epitopes from other C. jejuni proteins.

• In epitope mapping studies: Identifying immunodominant regions of UPF0059 could contribute to rational design of multi-epitope vaccines targeting conserved regions of different membrane proteins.

• For serotype-independent protection: Since immunity to C. jejuni appears to be serotype-specific in humans, membrane proteins with conserved regions like UPF0059 might provide broader protection across multiple serotypes .

To advance this research, similar approaches to those used with PorA would be valuable, including:

• Oral immunization studies in animal models

• Assessment of both serum and intestinal lavage fluid antibodies

• Protection studies against colonization with homologous and heterologous strains

• Combination with appropriate mucosal adjuvants such as modified heat-labile enterotoxin of E. coli

What are the challenges in studying membrane proteins like UPF0059 and how can they be overcome?

Challenge-Solution Matrix for Membrane Protein Research:

Researchers studying MOMP from C. jejuni have encountered similar challenges, particularly related to maintaining native conformation. For instance, MOMP's ability to inhibit bacterial attachment was partially retained when isolated under native conditions but completely lost when isolated with SDS , highlighting the importance of purification conditions for functional studies.