Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Functional Role in C. jejuni Biology

Lnt is a membrane-bound enzyme responsible for:

  • Lipoprotein maturation: Transfer of acyl groups to apolipoproteins, enabling their integration into bacterial membranes.

  • Virulence modulation: Indirectly influences lipooligosaccharide (LOS) biosynthesis, a key virulence factor linked to Guillain-Barré syndrome .

  • Regulatory interactions: Operon association with racR-racS, a two-component system (TCR) governing stress response and colonization genes .

Studies using Lnt-deficient mutants revealed disrupted membrane integrity and attenuated virulence in vitro .

Antibiotic Resistance Studies

Lnt is not directly linked to resistance mechanisms, but recombinant Lnt aids in understanding membrane-related resistance factors. For example:

  • Beta-lactam resistance: C. jejuni harbors blaOXA genes (e.g., blaOXA-61), which are horizontally transferred and may co-occur with lipid biosynthesis genes .

  • Efflux pump regulation: The CmeABC multidrug efflux system, present in >90% of clinical isolates, interacts with membrane proteins influenced by Lnt .

Virulence and Pathogenesis

  • LOS biosynthesis: Lnt’s role in lipid anchoring correlates with LOS stability, which is critical for host cell adhesion and immune evasion .

  • Toxin production: Cytolethal distending toxin (CDT), a C. jejuni virulence factor, requires functional membranes for secretion .

Comparative Genomic Insights

Genomic studies highlight lnt conservation across C. jejuni lineages:

FeatureFindingsSource
Gene prevalenceDetected in 100% of sequenced C. jejuni strains (n=112)
Operon structureCo-transcribed with racR-racS TCR system in serotype O:2
Sequence variability<1% amino acid divergence across clinical isolates

Industrial and Clinical Relevance

  • Diagnostic tools: Recombinant Lnt is used in ELISA kits for detecting C. jejuni antibodies in patient sera .

  • Therapeutic targeting: Membrane biogenesis pathways involving Lnt are potential targets for novel antimicrobials .

Challenges and Future Directions

  • Stability issues: Recombinant Lnt requires glycerol (50%) for long-term storage and is sensitive to freeze-thaw cycles .

  • Functional redundancy: Overlapping roles with other acyltransferases complicate phenotypic studies .

  • Vaccine development: Preliminary studies suggest Lnt-derived peptides could serve as vaccine candidates, but efficacy trials are pending .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; Cj1095; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-441
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
lnt
Target Protein Sequence
MKLKLNFLPYFSFIPKKLNTNSIIFKIIKVFFIAILLSNSIYLSFFENIFTQTISPFLAI WGLVLLLKSKTSKQYFWIGFFVGILWFWWIGLSSIYFNLNYLVPIIPIIIGFIYGLLFRL CYLLKFDFLRLCGIFCISFIHPLGFDWFNWGIFTVYGFFDPSYRGIICIFLIAYFIYEGY ISRYYKIAIVLILFFSGFQYNEKQAQTLNLNYKLINTNISQDQKFLQENLKSNSDILIQD ILQAINEKKELVILPETAFAFDLKNTKYELMLKELSYKITIITGAFHVEKEHTYNSTYIF KKGNVYILNKHFLVPFGEEIPFFKDLTKKYFLKNIEEFSKGPIQSKYKLDNQIITNAICY EATKEQNYQNSQIIIALSNNAWFNNSSEYKLQQLLMKFYASKYGVSVYHATNGKENIVIL PKKLLSKDWKNLSKEIFNDKK
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links

KEGG: cje:Cj1095

STRING: 192222.Cj1095

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) in Campylobacter jejuni and what is its basic function?

Apolipoprotein N-acyltransferase (lnt) is a membrane-bound enzyme in Campylobacter jejuni that plays a critical role in lipoprotein biosynthesis. The full-length protein (441 amino acids) functions in the final step of lipoprotein maturation by catalyzing the N-acylation of apolipoproteins . This process is essential for proper membrane protein anchoring and bacterial cell envelope integrity, contributing to the organism's survival and pathogenicity. The protein is encoded by the lnt gene (also known as Cj1095) and has been assigned UniProt ID Q9PNJ9 . Recombinant forms of this protein, such as the His-tagged version expressed in E. coli, serve as valuable tools for studying the structural and functional characteristics of this enzyme in research settings.

What are the optimal expression conditions for producing functional recombinant C. jejuni lnt protein?

For optimal expression of functional recombinant C. jejuni lnt protein, researchers should consider several critical parameters. The most effective system uses E. coli as the expression host with a vector containing an N-terminal His-tag for purification purposes . Temperature regulation is crucial during expression; induction should be performed at lower temperatures (16-20°C) to reduce inclusion body formation and maintain proper membrane integration of this transmembrane protein.

After expression, purification via nickel affinity chromatography should be performed in the presence of mild detergents to maintain protein stability and function. The purified protein should be maintained in a suitable buffer containing 6% trehalose at pH 8.0 to preserve activity . For storage, aliquoting the protein and storing at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles. When reconstituting the lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage stability .

What methodological approaches are most effective for studying the enzymatic activity of recombinant lnt in vitro?

To effectively study the enzymatic activity of recombinant C. jejuni lnt in vitro, researchers should implement a multi-faceted methodological approach. The most reliable assay system involves using synthetic lipopeptide substrates that mimic the natural diacylated apolipoprotein substrates. The reaction should be conducted in a micellar system containing appropriate detergents that maintain enzyme solubility while allowing access to lipid substrates.

Activity can be measured through several complementary techniques:

  • Mass spectrometry analysis: To directly detect and quantify the formation of triacylated lipoproteins from diacylated substrates.

  • Radiolabeled fatty acid incorporation: Using radiolabeled acyl donors to track the transfer reaction quantitatively.

  • Fluorescence-based assays: Employing fluorescently labeled substrates or products to monitor reaction kinetics in real-time.

For structural studies that complement enzymatic analyses, researchers should consider membrane mimetic systems such as nanodiscs or liposomes of defined composition, as these better replicate the native environment of this membrane-bound enzyme compared to detergent micelles alone. When analyzing the substrate specificity, it's important to test various phospholipid donors, as C. jejuni lnt may exhibit different preferences compared to other bacterial lnt enzymes .

How does lnt contribute to the virulence of Campylobacter jejuni?

Apolipoprotein N-acyltransferase (lnt) contributes significantly to C. jejuni virulence through its essential role in lipoprotein maturation. Properly processed lipoproteins are crucial for multiple aspects of Campylobacter pathogenesis. Unlike mutations in the deeper inner core structures of lipooligosaccharides (such as waaC mutations) that substantially reduce invasion capacity, mutations in less critical regions of the lipoprotein processing pathway do not necessarily eliminate invasion capabilities .

Specifically, lnt ensures proper anchoring of numerous virulence-associated lipoproteins to the bacterial outer membrane, affecting:

  • Membrane integrity and stress resistance: Properly processed lipoproteins contribute to envelope stability, which is essential for survival during host colonization.

  • Host cell interactions: Several adhesins and invasins are lipoproteins that require proper processing for function.

  • Immune evasion: Modified surface lipoproteins help evade host immune recognition patterns.

This protein's function appears to be part of a complex network of factors that contribute to C. jejuni's status as one of the leading causes of bacterial gastroenteritis worldwide, responsible for over 845,000 illnesses annually in the United States alone .

What is the relationship between lnt function and antibiotic resistance in C. jejuni populations?

While lnt itself is not directly an antibiotic resistance determinant, its function is integrally connected to C. jejuni's antibiotic resistance profile through several mechanisms. Genomic epidemiology studies have revealed that C. jejuni populations exhibit remarkable diversity in antibiotic resistance patterns, with 90.4% of clinical isolates carrying at least one horizontally acquired resistance gene .

The relationship between lnt function and antibiotic resistance operates through:

The genomic structure of C. jejuni populations is characterized by multiple independent acquisitions of resistance genes from five classes of antibiotics, and the distribution of these resistance determinants is influenced by the population's recombination dynamics . Understanding lnt's role in membrane integrity provides context for how these resistance determinants may spread and function within bacterial populations.

How has the lnt gene evolved across different Campylobacter jejuni strains and what implications does this have for functional studies?

Genomic analysis of C. jejuni populations reveals that the lnt gene is subject to evolutionary pressures that reflect its importance in bacterial physiology. Studies of clinical isolates have demonstrated a remarkably diverse C. jejuni population composed of numerous sequence types, with minimal geographical structure and evidence of widespread geographical mixing .

The evolution of the lnt gene in C. jejuni exhibits several important patterns:

  • Core genome conservation: As part of the cellular machinery for lipoprotein processing, the lnt gene is generally conserved within the core genome of C. jejuni, maintaining essential catalytic domains.

  • Microevolutionary variation: Despite core conservation, microevolution is evident with small nucleotide polymorphisms that may affect protein function subtly across different strains.

  • Recombination impact: Recombination in C. jejuni populations occurs with varying fragment sizes, with the majority encompassing short DNA segments (median size of 116 bp) and less frequent large recombination events (>2,000 bp) . This pattern of frequent microrecombinations and rare macrorecombinations contributes to genetic diversity, which could potentially affect lnt functionality or expression between strains.

For functional studies, these evolutionary patterns imply that researchers must carefully select representative strains when studying lnt function, as findings may not be universally applicable across all C. jejuni lineages. Experiments should ideally incorporate multiple strains to account for potential functional variations in lnt activity or substrate specificity resulting from evolutionary divergence .

What insights do comparative genomic analyses provide regarding the recombination patterns of genes related to lipoprotein biosynthesis in C. jejuni?

Comparative genomic analyses reveal that genes involved in lipoprotein biosynthesis, including lnt, exhibit distinctive recombination patterns that contribute to C. jejuni's adaptive capabilities. Studies analyzing genomic data from clinical isolates demonstrate that recombination plays a crucial role in shaping the genomic structure of C. jejuni populations .

Analysis of recombination in core genes and shared accessory genes reveals:

The implications for genes involved in lipoprotein biosynthesis are significant; these patterns suggest that while core functions are maintained, subtle variations may arise through recombination events that could affect enzyme efficiency, substrate specificity, or regulatory control. This genomic plasticity likely contributes to C. jejuni's ability to adapt to different host environments and may influence pathogenicity characteristics. For research focusing on lnt and related proteins, these findings emphasize the importance of considering the recombination history of specific strains when interpreting functional data .

What structural motifs in C. jejuni lnt are essential for catalytic activity and how do they compare to other bacterial acyltransferases?

The C. jejuni Apolipoprotein N-acyltransferase (lnt) contains several structural motifs that are essential for its catalytic activity. Analysis of the 441-amino acid sequence reveals conserved domains that facilitate its membrane association and enzymatic function .

Key structural motifs include:

  • Transmembrane domains: The protein contains multiple hydrophobic segments that anchor it to the membrane, with characteristic residue patterns that distinguish it from other bacterial membrane proteins.

  • Catalytic triad/tetrad: While the exact catalytic residues must be confirmed experimentally for the C. jejuni enzyme, sequence analysis suggests the presence of conserved catalytic residues typical of the nitrilase superfamily of enzymes.

  • Substrate-binding pocket: Regions that accommodate both the lipid donor and the apolipoprotein acceptor substrates.

These motifs in C. jejuni lnt differ somewhat from those in other bacterial acyltransferases. Unlike the E. coli enzyme, which has been more extensively characterized, the C. jejuni protein may have structural adaptations that reflect its function in the unique membrane environment of this pathogen. The transmembrane organization and surface-exposed catalytic domains likely evolved to function optimally at the higher temperature (42°C) at which C. jejuni thrives in its host environment .

How do mutations in specific domains of lnt affect its interaction with the lipooligosaccharide (LOS) biosynthesis pathway?

While lnt primarily functions in lipoprotein maturation, research suggests complex interactions between lipoprotein processing and the LOS biosynthesis pathway in C. jejuni. Studies of LOS core biosynthesis have shown that mutations in various glycosyltransferases affect the LOS structure and subsequent bacterial pathogenicity .

The relationship between lnt mutations and LOS biosynthesis appears to involve:

  • Indirect effects through membrane organization: Properly processed lipoproteins contribute to membrane architecture, which may affect the localization and function of LOS biosynthetic enzymes.

  • Shared regulatory pathways: The expression and activity of both lipoprotein processing and LOS biosynthesis may be co-regulated in response to environmental conditions.

  • Potential moonlighting functions: Some enzymes may have secondary roles that bridge these pathways.

What protocols are most effective for detecting and characterizing Campylobacter jejuni in environmental and clinical samples?

Detection and characterization of C. jejuni in environmental and clinical samples require robust methodological approaches. Based on current research, the most effective protocols combine culture-based methods with molecular confirmation techniques:

  • Selective culture methods: Initial isolation using modified charcoal-cephalexin deoxycholate agar (mCCDA) at 42°C under microaerobic conditions for 44 ± 4 hours, followed by subculture on blood agar for pure colonies .

  • Molecular identification: Multiplex PCR using specific primers targeting Campylobacter genus and species-specific markers provides reliable identification. The PCR conditions typically involve: 95°C for 5 min, 35 cycles at 94°C for 30 s, 55°C for 30 s and 72°C for 1 min, followed by 72°C for 7 min .

  • Confirmation by MALDI-TOF/MS: Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry provides rapid and accurate confirmation of C. jejuni identification at the species level .

For advanced characterization, whole genome sequencing has emerged as a powerful tool for epidemiological studies, revealing the remarkable diversity of C. jejuni populations. Analysis of clinical isolates has demonstrated that populations may be composed of numerous sequence types, with evidence of widespread geographical mixing and minimal local diversification .

How can recombinant lnt be utilized in developing new diagnostic tools or therapeutic strategies against Campylobacter infections?

Recombinant C. jejuni lnt protein offers several promising applications for developing novel diagnostic tools and therapeutic strategies:

  • Serological diagnostics: Purified recombinant lnt can serve as an antigen for developing highly specific antibody-based detection systems for C. jejuni infections. The protein's specificity to Campylobacter makes it a valuable biomarker for distinguishing this pathogen from other enteric bacteria.

  • Vaccine development: As a conserved membrane protein with enzymatic activity essential for bacterial viability, lnt represents a potential target for vaccine development. Recombinant lnt could be utilized in subunit vaccine formulations, potentially eliciting protective immunity against C. jejuni.

  • Drug discovery platforms: The availability of purified, functional recombinant lnt enables high-throughput screening for small molecule inhibitors of the enzyme. Since lnt activity is crucial for membrane integrity and bacterial survival, specific inhibitors could represent a new class of antimicrobials.

  • Structure-based drug design: Detailed structural characterization of recombinant lnt could facilitate rational drug design approaches targeting this enzyme.

Given the high prevalence of antibiotic resistance in C. jejuni populations, with 90.4% of clinical isolates carrying at least one horizontally acquired resistance gene , novel therapeutic approaches targeting conserved bacterial processes like lipoprotein processing represent a promising strategy. The recombinant protein's availability in a stable, His-tagged form facilitates these applications by providing a reliable source of the protein for various experimental platforms .

What are the major challenges in working with membrane proteins like lnt, and what strategies can overcome these limitations?

Working with membrane proteins like C. jejuni lnt presents several significant technical challenges due to their hydrophobic nature and structural complexity. The major challenges and corresponding solutions include:

  • Expression and solubility issues:

    • Challenge: Membrane proteins often form inclusion bodies or toxic aggregates during expression.

    • Solution: Using specialized E. coli strains designed for membrane protein expression, lower induction temperatures (16-20°C), and controlled expression rates with weaker promoters or lower inducer concentrations can improve yields of properly folded protein .

  • Purification complexity:

    • Challenge: Extracting membrane proteins from their native environment while maintaining structure and function.

    • Solution: Employing mild detergents appropriate for membrane protein extraction, such as n-dodecyl-β-D-maltoside (DDM) or digitonin, followed by affinity purification using the His tag .

  • Stability during storage:

    • Challenge: Membrane proteins often denature during storage or freeze-thaw cycles.

    • Solution: Addition of stabilizing agents such as trehalose (6%) in the storage buffer, maintaining appropriate pH (8.0), and avoiding repeated freeze-thaw cycles by preparing single-use aliquots with 5-50% glycerol .

  • Functional assay development:

    • Challenge: Creating conditions that mimic the native membrane environment for activity assays.

    • Solution: Reconstituting the protein in liposomes or nanodiscs that better replicate the native membrane environment for functional studies.

These technical strategies are essential for generating the high-quality recombinant protein needed for structural studies, enzymatic assays, and applications in diagnostics or drug discovery.

How can researchers address the issue of genetic variability when studying lnt function across different C. jejuni strains?

The genetic variability of C. jejuni presents significant challenges for researchers studying lnt function across different strains. Genomic epidemiology studies have revealed remarkably diverse populations with numerous sequence types and evidence of frequent recombination . To address these challenges, researchers should implement several strategic approaches:

  • Comparative genomic analysis:

    • Perform comprehensive sequence analysis of lnt genes from multiple strains to identify conserved regions versus variable domains.

    • Use this information to design experiments that target conserved functional domains while accounting for strain-specific variations.

  • Multi-strain validation:

    • Test hypotheses across representative strains from different clades or sequence types.

    • Include both laboratory reference strains and recent clinical isolates to ensure relevance to currently circulating pathogens.

  • Recombination-aware experimental design:

    • Consider the impact of recombination on gene function when interpreting phenotypic data.

    • Account for the geometric distribution of recombination fragment sizes (median size of 116 bp with less frequent large recombination events) .

  • Standardized functional assays:

    • Develop robust, quantitative assays that can detect subtle functional differences in lnt activity between strains.

    • Include appropriate controls to normalize for strain-specific background effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.