Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in C. jejuni

The ATP synthase complex in C. jejuni is essential for energy metabolism and oxidative phosphorylation. Subunit a (atpB) forms part of the membrane-embedded F0 sector, enabling proton translocation to power ATP synthesis . Studies suggest ATP synthase activity influences:

  • Bacterial motility and chemotaxis via proton gradient maintenance .

  • Stress adaptation, including responses to osmotic and oxidative stress .

  • Host-pathogen interactions, as ATP synthase subunits are conserved across C. jejuni strains and may contribute to virulence .

Recombinant Production and Quality Control

The protein is synthesized using heterologous expression systems (e.g., E. coli) with tags (e.g., His-tag) for affinity purification . Critical steps include:

  • Cloning: The atpB gene (CJ0581 locus) is inserted into expression vectors under inducible promoters .

  • Purification: Immobilized metal affinity chromatography (IMAC) ensures high yield and purity .

  • Validation: Confirmed via SDS-PAGE (>85% purity) and mass spectrometry .

Stability Considerations:

  • Avoid repeated freeze-thaw cycles; store aliquots at -80°C .

  • Reconstitute in Tris/PBS buffers with glycerol for long-term stability .

Antigenic Studies

Recombinant atpB is used to generate antibodies for detecting C. jejuni in clinical and environmental samples . Its conserved sequence across serotypes makes it a candidate for broad-spectrum diagnostic tools .

Comparative Genomics

Horizontal gene transfer (HGT) studies reveal atpB alleles are conserved but undergo recombination, contributing to genomic diversity and antibiotic resistance .

Relevance to Antimicrobial Resistance

ATP synthase is a potential drug target due to its essential role in energy metabolism. Mutations in related efflux pumps (e.g., cmeABC) correlate with fluoroquinolone and macrolide resistance in C. jejuni, suggesting interconnected stress-response mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Cj1204c; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
atpB
Target Protein Sequence
MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLGEAFLEGVL SMGRDTMGSEKGARKYLPLVATLGIIVFFSNIIGIIPGFHAPTASLNLTLSLAIIVFVYY HFEGIRAQGFVKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEEGH
Uniprot No.

Target Background

Function
This protein plays a crucial role in proton translocation across the membrane, serving as a key component of the proton channel.
Database Links

KEGG: cje:Cj1204c

STRING: 192222.Cj1204c

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Campylobacter jejuni?

ATP synthase subunit a (atpB) in C. jejuni is an integral membrane protein that forms part of the F₀ domain of the ATP synthase complex. This protein creates a pathway for proton translocation across the bacterial membrane, which drives ATP synthesis. While detailed structural information specific to C. jejuni atpB is limited, comparative studies with other bacterial species suggest it contains multiple transmembrane helices with crucial charged residues that facilitate proton movement. The protein works in conjunction with the c-ring to convert the energy of the proton gradient into mechanical rotation, ultimately resulting in ATP production .

How does the atpB gene in C. jejuni compare with other bacterial species?

The atpB gene in C. jejuni shows evolutionary conservation with other bacterial ATP synthase subunit a genes but has distinct characteristics reflecting its adaptation to the unique environment of this pathogen. Unlike mitochondrial ATP synthase where subunit a is encoded by the mitochondrial DNA ATP6 gene, in C. jejuni the gene is chromosomally encoded . Sequence analysis reveals conserved functional domains essential for proton translocation but with specific variations that may contribute to the optimal function of ATP synthase under the microaerophilic conditions preferred by C. jejuni. These differences may be particularly important when considering serotype-specific variations within the C. jejuni species.

Why is serotype O:2 of C. jejuni significant in atpB research?

Serotype O:2 of C. jejuni is one of the clinically important serotypes frequently associated with human gastroenteritis. This serotype has distinct lipopolysaccharide (LPS) and lipooligosaccharide (LOS) structures that contribute to its virulence and immunogenicity . Studying the atpB gene from this specific serotype provides insights into how energy metabolism may be linked to virulence characteristics and survival mechanisms in a clinically relevant strain. Additionally, serotype-specific research enables comparative studies across different C. jejuni lineages to understand evolutionary adaptations in essential cellular machinery.

What are the optimal strategies for cloning and expressing recombinant C. jejuni atpB?

The most effective strategy for recombinant expression of C. jejuni atpB involves careful consideration of expression systems, codon optimization, and purification approaches. Based on successful methods used for other C. jejuni membrane proteins, the following approach is recommended:

  • Gene synthesis with codon optimization for the expression host (typically E. coli)

  • Cloning into an expression vector containing:

    • A strong inducible promoter (e.g., T7)

    • A fusion tag (e.g., His-tag, thioredoxin) to improve solubility and facilitate purification

    • A protease cleavage site for tag removal

E. coli BL21(DE3) typically serves as an effective expression host, though specific conditions require optimization. The pET expression system has demonstrated success for similar C. jejuni proteins, as seen with Omp18 and MOMP antigens .

Expression conditions that require optimization include:

  • Induction temperature (typically 16-25°C for membrane proteins)

  • Inducer concentration

  • Expression duration

  • Media composition (often supplemented with specific ions or cofactors)

What purification methods are most effective for recombinant C. jejuni atpB?

Purification of recombinant C. jejuni atpB requires specialized approaches due to its hydrophobic nature as a membrane protein. The following multi-step purification strategy has proven effective for similar proteins:

  • Membrane extraction: Isolate bacterial membranes through differential centrifugation after cell lysis.

  • Solubilization: Use mild detergents (DDM, LDAO, or C₁₂E₈) to extract the protein from the membrane fraction.

  • Affinity chromatography: Employ metal affinity chromatography (IMAC) using His-tag affinity, with gradient elution for optimal purity.

  • Refolding: Implement on-column refolding by gradually decreasing urea concentration during purification, as demonstrated effective for other C. jejuni membrane proteins .

  • Size exclusion chromatography: Further purify the protein and confirm its oligomeric state.

Quality control assessments should include SDS-PAGE, western blotting with anti-His antibodies, and mass spectrometry (LC-MS/MS) to confirm protein identity and purity, similar to the approaches used for Omp18 and MOMP antigens .

How can researchers verify the proper folding and function of recombinant atpB?

Verification of proper folding and function of recombinant C. jejuni atpB should include multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate the compactness of the protein fold

    • Thermal shift assays to determine protein stability

  • Functional characterization:

    • Reconstitution into liposomes to measure proton translocation activity

    • ATP hydrolysis assays when assembled with other ATP synthase components

    • Proton gradient measurements using pH-sensitive fluorescent dyes

  • Interaction studies:

    • Pull-down assays to verify binding to other ATP synthase subunits

    • Cross-linking experiments to map interaction interfaces

    • Surface plasmon resonance to quantify binding affinities

The presence of appropriate detergents throughout these processes is crucial to maintain the native-like environment for this membrane protein.

How should researchers interpret differences between wild-type and recombinant atpB properties?

Interpreting differences between wild-type and recombinant atpB requires careful consideration of multiple factors:

ParameterPotential DifferencesInterpretation Approach
Molecular weightHigher MW for recombinant proteinAccount for fusion tags, additional residues from cloning sites
FoldingAltered secondary structure elementsCompare CD spectra quantitatively; consider detergent effects
ActivityReduced activity in recombinant proteinNormalize to protein concentration; evaluate specific activity
StabilityDifferent thermal or pH stabilityConsider expression system effects and buffer conditions
AntigenicityVaried antibody recognition patternsMap epitope accessibility; evaluate post-translational modifications

The expression system can significantly impact protein properties. For example, recombinant C. jejuni proteins expressed in E. coli often show increased molecular weight due to fusion tags, as observed with recombinant Omp18 (36 kDa compared to the native 18 kDa) . Additionally, the bacterial lipid environment differs between C. jejuni and expression hosts, potentially affecting membrane protein folding and function.

What analytical methods are most informative for characterizing atpB interactions with other ATP synthase components?

Characterizing atpB interactions with other ATP synthase components requires a multi-faceted analytical approach:

  • Co-purification studies: Identifying stable complexes between atpB and other subunits using tandem affinity purification approaches.

  • Blue Native PAGE: Analyzing intact complexes and subcomplexes to determine the assembly state and stability of atpB-containing complexes.

  • Cross-linking mass spectrometry (XL-MS): Identifying specific interaction interfaces through chemical cross-linking followed by mass spectrometric analysis.

  • FRET/BRET assays: Measuring proximity and dynamic interactions between fluorescently labeled subunits.

  • Cryo-electron microscopy: Visualizing the structural arrangement of atpB within the assembled ATP synthase complex.

These approaches have been successfully applied to study ATP synthase assembly in other organisms, revealing that the peripheral stalk is important for stability of the c-ring/F₁ complex and that subunit A6L provides a physical link between the proton channel and other peripheral stalk subunits .

How do mutations in the atpB gene affect ATP synthase function in C. jejuni?

Mutations in the atpB gene can profoundly impact ATP synthase function in C. jejuni through several mechanisms:

  • Proton translocation efficiency: Mutations in charged residues within transmembrane helices can disrupt the proton pathway, reducing or eliminating proton flow.

  • Interaction with c-ring: Amino acid changes at the interface with the c-ring can alter the rotational coupling mechanism essential for ATP synthesis.

  • Complex assembly: Mutations may disrupt proper assembly of the ATP synthase complex, as the assembly of mammalian ATP synthase involves the stepwise addition of components with the mitochondrial-encoded subunits (analogous to bacterial atpB) added in the final stages .

  • Protein stability: Some mutations destabilize the protein structure, leading to rapid degradation and reduced ATP synthase levels.

Functional analysis requires comparison of wild-type and mutant proteins through activity assays, thermal stability measurements, and structural assessments. In bacterial systems, complementation studies in atpB deletion strains provide valuable insights into the in vivo significance of specific mutations.

How does the recombinant expression of atpB contribute to understanding ATP synthase assembly in C. jejuni?

Recombinant expression of atpB provides critical insights into ATP synthase assembly in C. jejuni through several research approaches:

  • Assembly intermediate analysis: By expressing tagged versions of atpB along with other ATP synthase components, researchers can isolate and characterize assembly intermediates using blue native PAGE and proteomics approaches.

  • Timing of subunit incorporation: Pulse-chase experiments with recombinant components can reveal the sequence and kinetics of subunit incorporation into the complex.

  • Chaperone identification: Pull-down experiments with recombinant atpB can identify specific assembly chaperones that facilitate its incorporation into the ATP synthase complex.

Studies in yeast and mammalian systems suggest that ATP synthase assembly involves separate modules that converge at the end stage, with the mitochondrial-encoded subunits (equivalent to bacterial atpB) added in the final stages . In C. jejuni, this process likely follows a similar pattern but with species-specific assembly factors that could be identified through interaction studies with recombinant atpB.

What is the relationship between atpB and virulence mechanisms in C. jejuni serotype O:2?

The relationship between atpB and virulence in C. jejuni serotype O:2 represents a complex interplay between energy metabolism and pathogenicity:

  • Energy requirements for virulence: ATP synthesis is crucial for powering virulence-associated processes such as flagellar motility, adhesion, and invasion of host cells. Subtle variations in atpB efficiency could impact these energy-dependent processes.

  • Stress response coordination: AtpB function may be integrated with stress response mechanisms that are activated during host colonization, particularly in response to the acidic environment of the gastrointestinal tract.

  • Serotype-specific interactions: The O:2 serotype has distinct surface structures (LPS/LOS) that may interact differently with membrane proteins like atpB compared to other serotypes . These interactions could influence membrane organization and function.

  • Immune recognition: As a conserved protein, atpB itself is unlikely to be a primary antigenic target, but its function in maintaining bacterial fitness affects the expression of immunogenic surface structures.

Research approaches to explore these relationships include comparative proteomics of different serotypes, assessment of atpB mutants in colonization models, and metabolomic analysis of energy pathway intermediates during host cell interaction.

How do post-translational modifications affect atpB function in C. jejuni?

Post-translational modifications (PTMs) of atpB in C. jejuni represent an understudied area that may significantly impact protein function:

  • Phosphorylation: Phosphorylation of specific serine, threonine, or tyrosine residues may regulate atpB activity in response to cellular energy status or environmental signals.

  • Glycosylation: C. jejuni possesses N-linked protein glycosylation systems that may modify atpB, potentially affecting its stability or interaction with other proteins.

  • Lipid modifications: Interaction with specific membrane lipids may constitute a form of post-translational regulation that affects atpB function within the membrane environment.

  • Oxidative modifications: Reactive oxygen species encountered during host infection may modify sensitive residues in atpB, potentially as part of stress response mechanisms.

Detection and characterization of these PTMs require specialized mass spectrometry approaches, including enrichment strategies for modified peptides and site-specific analysis. Functional consequences can be assessed by comparing the activity of modified and unmodified protein, or through site-directed mutagenesis of modifiable residues to mimic or prevent modification.

What emerging technologies could advance research on C. jejuni atpB?

Several cutting-edge technologies show promise for advancing research on C. jejuni atpB:

  • Cryo-electron microscopy (cryo-EM): The resolution revolution in cryo-EM makes it possible to determine the structure of membrane protein complexes like ATP synthase at near-atomic resolution, potentially revealing serotype-specific features of C. jejuni ATP synthase.

  • AlphaFold and structural prediction: AI-based structural prediction tools can generate models of atpB structure and its interactions with other ATP synthase components, guiding experimental design and interpretation.

  • Single-molecule biophysics: Techniques like magnetic tweezers or fluorescence microscopy can directly measure the rotation and force generation of individual ATP synthase molecules containing recombinant atpB.

  • Nanodiscs and native-like membrane environments: These systems provide more physiological environments for studying membrane proteins like atpB, potentially preserving native structure and function better than detergent-based systems.

  • Cell-free expression systems: These may offer advantages for producing difficult membrane proteins like atpB by avoiding toxicity issues and allowing direct incorporation into membranes during synthesis.

How can recombinant atpB contribute to vaccine development against C. jejuni?

Recombinant atpB has potential applications in vaccine development against C. jejuni through several mechanisms:

  • Conserved epitope identification: As a highly conserved protein across C. jejuni strains, atpB may contain epitopes that generate cross-protective immunity against multiple serotypes.

  • Adjuvant carrier protein: The recombinant protein could serve as a carrier for serotype-specific antigens, enhancing their immunogenicity while providing protection against conserved epitopes.

  • Diagnostic tool development: Recombinant atpB can be used to develop serological assays to detect immune responses to C. jejuni, similar to the applications demonstrated for recombinant Omp18 and MOMP proteins .

Research approaches would include epitope mapping studies, immunization trials in animal models, and evaluation of protection against challenge with live bacteria. The development of recombinant antigens has already proven valuable for serological diagnostics of campylobacteriosis, suggesting similar potential for atpB .

What is the potential for targeting atpB in antimicrobial development?

The essential nature of ATP synthase makes atpB an attractive but challenging target for antimicrobial development:

  • Specific inhibitor design: Structural information about C. jejuni atpB could guide the design of specific inhibitors that block proton translocation without affecting human ATP synthase.

  • Species-selective targeting: Differences between bacterial and human ATP synthase can be exploited to develop compounds with selective toxicity for C. jejuni.

  • Combination approaches: Sub-inhibitory concentrations of ATP synthase inhibitors might synergize with other antibiotics by reducing bacterial energy production.

  • Resistance mechanism studies: Understanding how mutations in atpB might confer resistance to ATP synthase inhibitors would be crucial for effective drug development.

Research in this area would involve high-throughput screening of compound libraries against recombinant C. jejuni ATP synthase, followed by medicinal chemistry optimization and in vivo efficacy testing. The development of cell-based assays that specifically report on ATP synthase function would facilitate such screening efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.