Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit C in Campylobacter Jejuni

ATP synthase is a crucial enzyme complex that generates adenosine triphosphate (ATP) from adenosine diphosphate (ADP) and inorganic phosphate using energy derived from a transmembrane proton gradient. In Campylobacter jejuni, as in other bacteria, this enzyme plays a vital role in energy metabolism . The ATP synthase complex consists of two main domains: F₁, containing the extramembranous catalytic core, and F₀, containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk .

The atpE gene specifically encodes the c subunit of the F₀ sector, which forms a ring structure (c-ring) in the membrane. This c-ring is essential for proton translocation across the cell membrane and the subsequent synthesis of ATP . The atpE gene is part of the atp operon (atpAGDEFF'GH) and is notable for being more highly expressed than other genes in this operon .

Table 1: Key Properties of Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 ATP Synthase Subunit C

PropertyDescription
Source organismCampylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)
Gene ID905243
Protein length112 amino acids
Molecular functionComponent of F₀ sector of ATP synthase
Biological roleProton translocation and ATP synthesis
Cellular locationCell membrane
UniProt IDQ0P9W3

Functional Role in Bacterial Metabolism

The ATP synthase c subunit plays a crucial role in energy production within Campylobacter jejuni. The protein forms part of the c-ring in the F₀ domain of ATP synthase, which rotates as protons pass through the membrane. This rotation is mechanically coupled to conformational changes in the F₁ domain, leading to ATP synthesis .

The proton translocation process involves two half-channels: the periplasmic half-channel, through which protons enter the c-ring, and the cytoplasmic half-channel, through which they exit. When a proton enters through the periplasmic half-channel, it binds to the conserved glutamic acid residue (Glu 56) on a c subunit. The proton then rotates with the c-ring until it reaches the cytoplasmic half-channel, where it is released from the Glu residue due to interaction with the positively charged arginine residue (Arg 169) of the adjacent a subunit .

Expression Systems

Recombinant atpE protein from Campylobacter jejuni can be produced using various expression systems, with Escherichia coli being the most common host organism. The gene sequence encoding the atpE protein is typically synthesized de novo and optimized for expression in the chosen host . Common expression vectors include pET32, which can increase the solubility of the target protein by fusing it with thioredoxin .

Purification Techniques

The recombinant atpE protein can be purified using various chromatographic techniques. Most commonly, the protein is tagged with a histidine tag (His-tag) to enable purification by metal affinity chromatography . The typical purification workflow involves:

  1. Cell lysis to release the recombinant protein

  2. Affinity chromatography using a HisTrap column

  3. Refolding of the protein, if necessary, by gradually decreasing the urea concentration

  4. Buffer exchange to the final storage buffer

Table 2: Optimal Conditions for Expression of Recombinant atpE Protein

ParameterOptimal ConditionNotes
Expression HostE. coli BL21(DE3)Common strain for recombinant protein expression
VectorpET32Includes thioredoxin fusion for increased solubility
IPTG Concentration0.2 mMBased on optimization for similar membrane proteins
Temperature37°CHigher protein yield compared to lower temperatures
Purification MethodNi-NTA affinity chromatographyUtilizes His-tag for specific binding
Storage BufferTris-based buffer, 50% glycerolOptimizes protein stability during storage

Diagnostic Applications

Recombinant atpE protein has potential applications in the development of serological diagnostic tools for Campylobacter infections. As demonstrated with other Campylobacter membrane proteins, such proteins can be used to detect antibodies in the serum of infected animals or humans . The specificity of the atpE protein to Campylobacter jejuni makes it a potential candidate for species-specific diagnostics.

Vaccine Development

The recombinant atpE protein is of interest for vaccine development against Campylobacter jejuni. As a membrane protein expressed on the bacterial surface, it could potentially elicit a protective immune response. Creative Biolabs and other biotechnology companies offer this recombinant protein specifically for vaccine research applications .

Comparative Analysis with Other Campylobacter Serotypes

The atpE protein shows variations across different Campylobacter jejuni serotypes, which may reflect adaptations to different ecological niches or host environments. Comparative analysis of atpE proteins from different serotypes can provide insights into the evolution and adaptation of this pathogen.

Despite the progress in understanding the structure and function of bacterial ATP synthases, several aspects of the Campylobacter jejuni atpE protein remain to be explored:

  1. Detailed structural analysis using techniques such as cryo-electron microscopy to determine the specific architecture of the C. jejuni ATP synthase complex

  2. Investigation of potential species-specific inhibitors targeting the atpE protein, which could lead to novel antimicrobial strategies

  3. Exploration of the role of atpE in antimicrobial resistance, given the increasing concern about antimicrobial resistance in Campylobacter species

  4. Development of improved diagnostic tests and vaccines based on the recombinant atpE protein

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; Cj0936; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-112
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
atpE
Target Protein Sequence
MKKVLFLLLACTAVAFAAETNAPVEQEAINVWIKAFSVLAAGLGLGVAALGGAIGMGNTA AATIAGTARNPGLGPKLMTTMFIALAMIEAQVIYALVIALIALYANPFIVLQ
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes the production of ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits.
Database Links

KEGG: cje:Cj0936

STRING: 192222.Cj0936

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit c (atpE) in Campylobacter jejuni?

ATP synthase subunit c, encoded by the atpE gene, is a critical component of the F-type ATP synthase complex in Campylobacter jejuni. This protein forms part of the F0 sector of the ATP synthase, which is embedded in the cellular membrane. It functions as an ion channel that facilitates proton translocation across the membrane, contributing to the proton-motive force that drives ATP synthesis. In C. jejuni, this protein plays an essential role in energy metabolism and is also known as F-ATPase subunit c or lipid-binding protein according to its functional characteristics .

Why is Campylobacter jejuni ATP synthase subunit c important for research?

C. jejuni ATP synthase subunit c warrants scientific investigation for several key reasons. First, as a component of ATP synthase, it is central to the energy production that allows this foodborne pathogen to survive in diverse environments. C. jejuni can utilize various substrates for ATP production, including through oxidative phosphorylation via the electron transport chain, which involves ATP synthase . Additionally, understanding the structure and function of ATP synthase components can provide insights into potential antimicrobial targets, as disruption of energy metabolism can attenuate bacterial virulence. C. jejuni's sophisticated energy metabolism, which allows it to survive without growth in the food chain, makes proteins like ATP synthase subunit c particularly relevant for both basic microbiology research and applied food safety investigations .

What are the common synonyms and nomenclature for ATP synthase subunit c in scientific literature?

When conducting literature searches on this protein, researchers should be aware of multiple nomenclature variations:

  • ATP synthase subunit c (atpE)

  • ATP synthase F(0) sector subunit c

  • F-type ATPase subunit c

  • F-ATPase subunit c

  • Lipid-binding protein

The gene is primarily designated as atpE, but alternative gene identifiers include CJJ81176_0943 and cj0936 in different C. jejuni strains . Using these diverse terms in literature searches ensures comprehensive coverage of relevant research.

What expression systems are optimal for producing recombinant C. jejuni ATP synthase subunit c?

The production of recombinant C. jejuni ATP synthase subunit c can be achieved through several expression systems, each with specific advantages depending on research requirements:

  • E. coli expression systems: Most commonly used due to rapid growth, high yield, and economic efficiency. E. coli BL21(DE3) or similar strains are typically employed when native protein confirmation is not critical .

  • Yeast expression systems: Preferable when post-translational modifications may affect protein function. Yeast systems like Pichia pastoris provide eukaryotic processing capabilities while maintaining relatively high yields.

  • Baculovirus expression systems: Appropriate for proteins requiring complex folding or when E. coli expression results in inclusion bodies. This insect cell-based system often produces properly folded membrane proteins.

  • Mammalian cell expression systems: Though lower yielding, these systems provide the most sophisticated post-translational modifications and are used when protein activity depends on specific mammalian-type modifications.

For most basic research purposes examining ATP synthase subunit c structure or for antibody production, E. coli systems remain the standard choice due to their straightforward implementation and cost-effectiveness .

What purification protocols yield the highest purity for functional studies of atpE?

Purification of ATP synthase subunit c presents challenges due to its hydrophobic nature as a membrane protein. A systematic purification approach includes:

  • Cell lysis: Sonication or French press in buffer containing mild detergents (e.g., n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane proteins.

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged recombinant proteins, with careful optimization of imidazole concentrations for washing and elution steps.

  • Secondary purification: Size exclusion chromatography to remove aggregates and obtain homogeneous protein samples.

  • Quality assessment: SDS-PAGE analysis followed by Western blotting against the recombinant tag or using specific antibodies to confirm identity and purity.

  • Storage considerations: Stabilization in buffer containing glycerol (typically 10-20%) and storage at -20°C for short-term use or -80°C for extended periods. Importantly, repeated freeze-thaw cycles should be avoided, and working aliquots should be maintained at 4°C for up to one week .

Researchers should aim for >90% purity for most functional and structural studies, which is typically achievable using this multi-step approach.

How can researchers optimize storage conditions to maintain atpE stability and activity?

Maintaining structural integrity and functional activity of ATP synthase subunit c requires careful consideration of storage conditions:

  • Temperature management: Store stock solutions at -20°C for routine use, or at -80°C for long-term preservation. For frequent access, maintain working aliquots at 4°C for a maximum of one week .

  • Cryoprotectant addition: Incorporate glycerol (typically 10-20%) in storage buffers to prevent ice crystal formation during freezing, which can denature proteins .

  • Aliquoting strategy: Divide purified protein into single-use aliquots to eliminate repeated freeze-thaw cycles, which significantly compromise protein integrity.

  • Buffer optimization: Maintain pH stability (typically pH 7.2-7.5) and include reducing agents (e.g., 1-5 mM DTT or β-mercaptoethanol) if the protein contains critical cysteine residues.

  • Stabilizing additives: Consider specific additives based on downstream applications. For membrane proteins like atpE, including small amounts of detergent at concentrations above the critical micelle concentration can maintain solubility.

These protocols significantly extend shelf-life while preserving the biological activity necessary for meaningful experimental results .

How does ATP synthase subunit c contribute to C. jejuni energy metabolism?

ATP synthase subunit c plays a fundamental role in C. jejuni energy production through its function in the F0 sector of ATP synthase. The contribution of this protein to cellular metabolism can be understood through several mechanisms:

  • Proton translocation: As part of the membrane-embedded F0 sector, subunit c forms the c-ring structure that rotates during proton movement across the membrane. This rotation mechanically couples proton flow to ATP synthesis in the F1 sector.

  • Integration with electron transport chain: C. jejuni possesses a flexible electron transport chain that can utilize various electron donors and acceptors. The proton gradient established by this chain directly drives ATP synthesis through the ATP synthase complex containing subunit c .

  • Adaptation to environmental conditions: C. jejuni can adjust its energy metabolism based on available substrates. The ATP synthase complex is crucial for ATP production under varying conditions, allowing the bacterium to survive in oxygen-limited environments typical of the food chain .

  • Support for non-growth survival: Research has demonstrated that C. jejuni can maintain metabolic activity without growth through amino acids, organic acids, and H₂ as single substrates. ATP synthesis through oxidative phosphorylation, which depends on ATP synthase function, is a key mechanism supporting this survival capability .

This metabolic flexibility and energy production capacity contribute significantly to C. jejuni's remarkable ability to persist in diverse environments despite its fastidious nature under laboratory conditions.

What experimental approaches can quantify ATP synthase activity in C. jejuni?

Researchers investigating ATP synthase function in C. jejuni can employ several complementary methodologies:

  • Biochemical ATP synthesis/hydrolysis assays:

    • ATP synthesis can be measured using luciferase-based assays that quantify ATP production in inverted membrane vesicles upon establishment of a proton gradient

    • ATPase activity can be assessed by measuring inorganic phosphate release using colorimetric methods like the malachite green assay

  • Membrane potential measurements:

    • Fluorescent probes like DiSC3(5) or JC-1 can be used to monitor membrane potential changes associated with ATP synthase activity

    • These measurements can be performed under various substrate conditions to assess the impact of different electron donors and acceptors

  • Oxygen consumption analysis:

    • Clark-type oxygen electrodes or more advanced respirometry techniques can measure respiratory activity linked to ATP synthase function

    • This approach is particularly valuable for understanding the relationship between the electron transport chain and ATP production in C. jejuni

  • Phenotypic microarrays:

    • Systems like Biolog phenotypic microarrays have been successfully employed to assess metabolic activity with different substrates

    • The reduction of tetrazolium dye indicates active respiration, providing insights into substrate utilization patterns linked to ATP synthesis

  • Genetic manipulation coupled with phenotypic assessment:

    • Mutational analysis of atpE or other ATP synthase components can reveal their contribution to growth, survival, and pathogenesis

    • Complementation studies confirm phenotype specificity and rule out polar effects

These methodologies provide complementary data on ATP synthase function in different physiological contexts, allowing researchers to comprehensively characterize this essential energy-producing complex.

How does C. jejuni ATP synthase activity vary under different environmental conditions?

C. jejuni demonstrates remarkable metabolic flexibility, adapting its ATP synthase activity to diverse environmental conditions:

  • Oxygen availability response:

    • Under microaerophilic conditions (preferred for growth), C. jejuni utilizes oxygen as the terminal electron acceptor through its cbb3-type cytochrome-c-oxidase or cytochrome bd-type quinol oxidase, driving ATP synthesis

    • In oxygen-limited environments, C. jejuni can switch to alternative electron acceptors like nitrate, fumarate, or other compounds to maintain ATP production through the ATP synthase complex

  • Substrate-dependent adaptation:

    • ATP synthase activity varies based on available carbon and energy sources

    • Research has identified amino acids, organic acids, and H₂ as single substrates supporting survival without growth

    • The efficiency of ATP production through ATP synthase depends on the specific substrate utilized and its downstream metabolic processing

  • Temperature effects:

    • C. jejuni is thermophilic, with optimal growth at 42°C

    • ATP synthase activity and stability are temperature-dependent, with significant reduction at temperatures below 30°C

    • This temperature sensitivity may contribute to C. jejuni's specific ecological niche

  • pH adaptation:

    • ATP synthase function is influenced by environmental pH, which affects the proton motive force

    • C. jejuni can maintain ATP synthesis within a relatively narrow pH range compared to other foodborne pathogens

This adaptability in energy metabolism, centered around ATP synthase function, contributes significantly to C. jejuni's remarkable ability to persist in diverse environments despite its fastidious nature in laboratory settings .

How can ATP synthase subunit c be exploited as a potential antimicrobial target?

The critical role of ATP synthase in bacterial energy metabolism makes subunit c an attractive antimicrobial target, especially in C. jejuni, which relies heavily on oxidative phosphorylation. Several strategic approaches can be considered:

  • Structure-based drug design:

    • The c-ring formation in ATP synthase presents unique structural features that can be targeted with small molecule inhibitors

    • Computational modeling of the C. jejuni-specific c-subunit can identify binding pockets distinct from human ATP synthase homologs

  • Natural product screening:

    • Several naturally occurring compounds, including polyphenols and certain alkaloids, show inhibitory activity against bacterial ATP synthases

    • High-throughput screening of natural product libraries against recombinant C. jejuni ATP synthase can identify novel inhibitors

  • Peptide-based inhibitors:

    • Designing peptides that mimic the interface between subunit c monomers can disrupt c-ring assembly

    • These peptides can be optimized for specificity to bacterial ATP synthase over mammalian counterparts

  • Targeting regulatory mechanisms:

    • Understanding the expression regulation of atpE in C. jejuni can reveal opportunities to downregulate ATP synthase production

    • Research has shown that altering ribosomal methylation can disrupt the proteome composition, potentially affecting ATP synthase expression and assembly

  • Combination approaches:

    • ATP synthase inhibitors may show synergy with compounds targeting other aspects of C. jejuni metabolism

    • Combining ATP synthase inhibitors with compounds that block alternative energy production pathways can prevent compensatory metabolic shifts

What role does ATP synthase subunit c play in C. jejuni virulence and pathogenesis?

The contribution of ATP synthase subunit c to C. jejuni virulence extends beyond its primary role in energy production, intersecting with several pathogenicity mechanisms:

  • Energetic support for virulence factor expression:

    • ATP production is essential for synthesizing virulence factors required during infection

    • Disruption of ATP synthesis through alteration of ribosomal methylation has been shown to attenuate C. jejuni virulence, highlighting the connection between energy metabolism and pathogenesis

  • Adaptation to host environments:

    • ATP synthase activity enables C. jejuni to utilize various substrates available in the host intestinal tract

    • This metabolic flexibility, supported by functional ATP synthase, contributes to successful colonization and persistence

  • Stress response and survival:

    • Functional ATP synthesis is critical for mounting effective stress responses during host invasion

    • Energy availability determines the bacterium's ability to withstand host defense mechanisms

  • Biofilm formation contribution:

    • ATP synthase activity influences biofilm formation capacity

    • Energy production supports the synthesis of extracellular polymeric substances needed for biofilm matrix

  • Survival in food chain environments:

    • C. jejuni's ability to persist in foods despite preservation methods (like organic acid treatment) depends partly on ATP synthase function

    • Research has shown that C. jejuni can utilize organic acids commonly used for food preservation as energy sources, potentially involving ATP synthase in this process

These interconnections make ATP synthase subunit c an intriguing target for both fundamental virulence research and applied antimicrobial development. Experimental approaches linking energy metabolism to virulence, such as atpE mutant analysis in infection models, are providing valuable insights into these relationships.

How can researchers employ genome-scale metabolic modeling to understand ATP synthase function in C. jejuni metabolism?

Genome-scale metabolic modeling (GSM) offers powerful approaches to investigate ATP synthase function within the broader metabolic network of C. jejuni:

Table 1. Comparison of ATP Production Mechanisms in C. jejuni Based on GSM Analysis

MechanismElectron DonorsElectron AcceptorsRelative ATP YieldEnzyme InvestmentOxygen Requirement
Substrate-level phosphorylationN/AN/ALowLowNone
TCA cycle coupled with ETCNADH, FerredoxinO₂, NO₃⁻, FumarateHighHighVariable
Oxidative phosphorylation (ETC)H₂, Formate, NADHO₂HighestHighestYes (for O₂ as acceptor)
Alternative respiratory chainsAmino acids, Organic acidsAlternative acceptorsMediumMediumNo

This modeling approach provides researchers with a systems-level understanding of ATP synthase function that would be difficult to achieve through experimental methods alone .

What are common difficulties encountered when working with recombinant C. jejuni ATP synthase subunit c and how can they be addressed?

Researchers working with ATP synthase subunit c frequently encounter several challenges that require specific troubleshooting approaches:

  • Protein solubility issues:

    • Challenge: As a membrane protein, atpE often aggregates during expression and purification

    • Solution: Optimize expression conditions (lower temperature, reduced induction); use specialized detergents like n-dodecyl β-D-maltoside; consider fusion partners like MBP or SUMO to enhance solubility

  • Low expression yields:

    • Challenge: Membrane proteins typically express at lower levels than cytosolic proteins

    • Solution: Try different expression systems (E. coli strains C41/C43 specialized for membrane proteins); optimize codon usage for the host; consider larger culture volumes

  • Protein misfolding:

    • Challenge: Improper folding affecting functional studies

    • Solution: Express in eukaryotic systems for complex proteins; try chaperone co-expression systems; optimize buffer conditions during purification

  • Functional assessment difficulties:

    • Challenge: Isolated subunit c may not retain native functionality outside the ATP synthase complex

    • Solution: Consider co-expression with interacting subunits; reconstruct minimal functional units in liposomes; develop specialized activity assays

  • Storage stability problems:

    • Challenge: Purified protein showing degradation or activity loss during storage

    • Solution: Store with glycerol at -20°C or -80°C; avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week; consider lyophilization for long-term storage

  • Refolding challenges after denaturation:

    • Challenge: Difficulty refolding protein after purification under denaturing conditions

    • Solution: Employ gradual dialysis with decreasing denaturant concentration; add lipids or detergents to facilitate proper membrane protein folding

These technical challenges often require iterative optimization specific to each research laboratory's conditions and equipment.

How can researchers distinguish between the effects of ATP synthase inhibition and other metabolic perturbations in C. jejuni?

Differentiating ATP synthase-specific effects from broader metabolic changes requires a multi-faceted experimental approach:

  • Genetic approaches:

    • Create conditional mutants of ATP synthase components with tight expression control

    • Compare phenotypes of targeted atpE mutations with those affecting other ATP synthase subunits

    • Perform complementation studies with wild-type and mutant versions of atpE to confirm phenotype specificity

  • Pharmacological strategies:

    • Utilize ATP synthase-specific inhibitors (such as oligomycin) at titrated concentrations

    • Compare effects with inhibitors targeting other respiratory complexes

    • Perform time-course experiments to distinguish primary (direct) from secondary (adaptive) effects

  • Metabolomic analysis:

    • Measure changes in ATP/ADP ratios and energy charge to quantify bioenergetic impact

    • Monitor metabolite profiles to identify compensatory pathways activated upon ATP synthesis disruption

    • Compare metabolic signatures of ATP synthase inhibition with other metabolic perturbations

  • Combined experimental and computational approaches:

    • Apply genome-scale metabolic modeling to predict the network-wide consequences of ATP synthase inhibition

    • Compare model predictions with experimental observations to identify ATP synthase-specific effects

    • Use flux balance analysis to distinguish between direct effects on ATP production and secondary metabolic adjustments

  • Cellular phenotype assessment:

    • Evaluate growth, survival, motility, and virulence phenotypes under various conditions

    • Determine if phenotypes can be rescued by supplementation with alternative energy sources

    • Quantify membrane potential to separate effects on ATP synthesis from other membrane-related functions

These complementary approaches collectively provide a framework for attributing observed phenotypes specifically to ATP synthase function rather than general metabolic disruption.

What cutting-edge techniques are advancing our understanding of ATP synthase structure and function in C. jejuni?

Recent technological advances are transforming ATP synthase research in C. jejuni and other bacteria:

  • Cryo-electron microscopy applications:

    • Single-particle cryo-EM is revealing unprecedented structural details of bacterial ATP synthases, including c-ring stoichiometry and subunit interactions

    • These structures can identify C. jejuni-specific features that might be exploited for selective targeting

  • Native mass spectrometry:

    • This technique preserves non-covalent interactions during analysis, allowing researchers to study intact ATP synthase complexes

    • It provides insights into complex assembly, stability, and subunit stoichiometry in different conditions

  • Advanced fluorescence techniques:

    • Single-molecule FRET studies are tracking conformational changes during ATP synthesis

    • Super-resolution microscopy reveals the distribution and organization of ATP synthase complexes in bacterial membranes

  • Nanodiscs and advanced membrane mimetics:

    • Incorporation of purified ATP synthase into nanodiscs provides a near-native environment for functional studies

    • Polymer-based membrane mimetics improve stability for structural and functional investigations

  • CRISPR-based approaches:

    • CRISPR interference (CRISPRi) allows titratable repression of ATP synthase components to study partial inhibition effects

    • CRISPR-based gene editing creates precise mutations to study structure-function relationships

  • Multi-omics integration:

    • Integration of transcriptomics, proteomics, and metabolomics data with genome-scale metabolic models provides systems-level understanding of ATP synthase function

    • This approach has been successfully applied to study C. jejuni metabolism under various conditions

  • Computational molecular dynamics:

    • Atomistic simulations of the c-ring rotating mechanism provide insights into proton translocation

    • These simulations can predict effects of mutations or inhibitors on subunit c function

These cutting-edge techniques collectively promise to transform our understanding of ATP synthase structure, function, and potential as an antimicrobial target in C. jejuni.

What are the most promising future research directions for C. jejuni ATP synthase studies?

The evolving landscape of C. jejuni research suggests several high-priority directions for ATP synthase investigations:

  • Structural biology approaches: Determining C. jejuni-specific structural features of ATP synthase components, particularly the c-ring, could reveal unique aspects for selective targeting. Cryo-EM studies of the complete ATP synthase complex would provide invaluable insights into its assembly and function.

  • Integration with virulence mechanisms: Further exploration of how energy metabolism through ATP synthase intersects with virulence factor expression and deployment could reveal new connections between metabolism and pathogenesis .

  • Survival mechanisms in food chain: Detailed investigation of how ATP synthase contributes to C. jejuni's remarkable ability to survive in food preservation environments could lead to improved food safety interventions .

  • Antimicrobial development: Structure-guided design of ATP synthase inhibitors specific to C. jejuni could yield novel therapeutic approaches for this antibiotic-resistant pathogen.

  • Systems biology integration: Expanding genome-scale metabolic models to incorporate regulation of ATP synthase expression and activity under varying environmental conditions would enhance our understanding of C. jejuni adaptation mechanisms .

These research directions promise to advance both fundamental understanding of bacterial bioenergetics and applied approaches to controlling this significant foodborne pathogen.

How does research on C. jejuni ATP synthase contribute to broader understanding of bacterial bioenergetics?

Research on C. jejuni ATP synthase provides valuable insights into broader principles of bacterial energy metabolism:

  • Metabolic flexibility principles: C. jejuni's ability to utilize diverse substrates for ATP production demonstrates how bacteria adapt their energy metabolism to changing environments. The integration of ATP synthase with alternative electron transport chains illustrates fundamental principles of bioenergetic flexibility .

  • Non-growth survival mechanisms: Studies revealing how C. jejuni maintains ATP production during non-growth survival advance our understanding of bacterial persistence mechanisms relevant to many pathogens .

  • Evolutionary adaptations: Comparative analysis of ATP synthase components across bacterial species reveals evolutionary adaptations to specific ecological niches, contributing to our understanding of protein evolution.

  • Structure-function relationships: Research on C. jejuni ATP synthase c-subunit provides insights into the fundamental mechanisms of proton translocation and rotary catalysis conserved across F-type ATP synthases.

  • Metabolic network interactions: The integration of ATP synthase function with broader metabolic networks revealed through genome-scale metabolic modeling advances systems-level understanding of bacterial metabolism .

These contributions extend beyond C. jejuni biology, informing our fundamental understanding of how bacteria generate and utilize energy under varying environmental conditions—knowledge that impacts fields from microbial ecology to infectious disease research.

What ethical considerations should researchers address when developing ATP synthase inhibitors as potential antimicrobials?

The development of ATP synthase inhibitors targeting C. jejuni raises several important ethical considerations:

  • Selectivity challenges: Researchers must rigorously evaluate inhibitor selectivity between bacterial and human ATP synthases to minimize potential toxicity. This requires careful structural analysis and extensive testing in mammalian cell models.

  • Resistance development: The potential for resistance emergence must be assessed early in inhibitor development. Ethical research includes resistance frequency studies and investigation of resistance mechanisms to inform clinical deployment strategies.

  • Environmental impact: As ATP synthase is conserved across species, researchers must evaluate potential effects on beneficial microorganisms in the environment and human microbiome if such inhibitors were widely deployed.

  • Appropriate use frameworks: Researchers should contribute to developing guidelines for appropriate clinical use of any ATP synthase inhibitors to minimize selective pressure and resistance development.

  • Research resource allocation: Ethical considerations include balancing research investment between novel targets like ATP synthase and improving existing antimicrobial approaches, particularly for regions with limited healthcare resources.

  • Transparency in research: Full disclosure of both positive and negative findings regarding ATP synthase inhibitors is essential for scientific integrity and public trust.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.