Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
plsY; Cj0357c; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
plsY
Target Protein Sequence
MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLTLKFLHYDQALLWSVAVLAILGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVVSSFIFNYDLEIHTHAPVFIIAF IIVYKHLPNIKRLIFKEECKVI
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: cje:Cj0357c

STRING: 192222.Cj0357c

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of plsY in Campylobacter jejuni metabolism?

The plsY gene in Campylobacter jejuni encodes Glycerol-3-phosphate acyltransferase, a critical enzyme in bacterial phospholipid biosynthesis. This enzyme catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) - the first committed step in phospholipid synthesis. In C. jejuni, plsY is essential for maintaining membrane integrity and function, particularly important given C. jejuni's unique glycosylation patterns and membrane structures. The enzyme plays a vital role in the bacterium's adaptation to different environmental conditions, enabling survival outside the host until it can establish infection . Metabolic modeling studies have revealed that plsY functions within complex metabolic networks that determine C. jejuni's cellular physiology at the single-cell level, making it a significant target for understanding this pathogen's biology.

How does plsY differ between C. jejuni and other bacterial species?

The plsY enzyme in C. jejuni exhibits distinct characteristics compared to its counterparts in other bacterial species. While the core catalytic function remains conserved across bacteria, C. jejuni's plsY shows notable sequence and structural variations that likely reflect adaptation to its specific ecological niche. These differences may contribute to C. jejuni's unique membrane composition, which includes specialized glycolipids and glycoconjugates involved in host-pathogen interactions .

Unlike plsY enzymes found in model organisms like E. coli, C. jejuni plsY operates within a distinct metabolic context influenced by this organism's microaerophilic lifestyle and specialized nutrient acquisition systems. The enzyme's substrate specificity may also differ, potentially accepting a different range of fatty acyl donors compared to other bacteria . These differences are particularly relevant when considering C. jejuni's rapid evolution rate and extensive recombination capability, which drives genetic diversity at twice the rate of de novo mutation . Understanding these species-specific differences provides valuable insights into C. jejuni membrane biology and potential targets for intervention.

What are the expression patterns of plsY during different growth phases of C. jejuni?

The expression of plsY in C. jejuni demonstrates distinct patterns across different growth phases and environmental conditions. During exponential growth, plsY expression typically increases to support membrane biogenesis required for cell division. In contrast, during stationary phase or stress conditions, expression patterns shift as the bacterium prioritizes maintenance over growth.

Research indicates that C. jejuni adapts its membrane composition in response to environmental stressors through regulated expression of lipid biosynthesis genes including plsY. This regulation is particularly evident during temperature shifts, which C. jejuni experiences during transmission between avian hosts (42°C) and human hosts (37°C) . When C. jejuni forms biofilms, plsY expression may be altered to support the different membrane requirements of biofilm-associated cells. These expression patterns correlate with C. jejuni's ability to persist outside hosts despite its inability to grow in these environments . Metabolic models suggest that the regulation of plsY is integrated with broader cellular responses to environmental conditions, contributing to C. jejuni's adaptive capabilities.

How conserved is the plsY gene across different C. jejuni strains and serotypes?

The plsY gene exhibits remarkable conservation across C. jejuni strains and serotypes, reflecting its essential role in phospholipid biosynthesis. Comparative genomic analyses reveal that while C. jejuni demonstrates considerable genetic diversity in many genomic regions, core metabolic genes like plsY maintain higher sequence conservation.

Interestingly, despite this conservation, subtle variations in the plsY sequence can be observed between different serotypes (including O:2 and O:6), potentially contributing to membrane composition differences that may influence antigenicity and host interactions . These variations should be considered when producing recombinant versions of the protein for research or vaccine development. The gene's conservation stands in contrast to the significant heterogeneity observed in C. jejuni's lipooligosaccharide (LOS) and capsular polysaccharide (CPS) structures, which vary considerably between strains . This pattern of conservation amid diversity reflects the evolutionary pressures on C. jejuni, where essential metabolic functions remain preserved while surface structures evolve rapidly to evade host immunity and adapt to different environments .

How does recombinant C. jejuni plsY activity compare to the native enzyme in vitro?

Recombinant C. jejuni plsY protein demonstrates important functional differences compared to the native enzyme when studied in vitro. These differences primarily stem from post-translational modifications present in the native protein but potentially absent in recombinant versions, depending on the expression system used. Since C. jejuni was the first bacteria identified with a mechanism for N-linked protein glycosylation , proteins expressed in heterologous systems like E. coli may lack critical glycosylation patterns that affect enzyme kinetics, substrate specificity, or stability.

Kinetic analyses typically reveal that recombinant plsY expressed in E. coli (the most common expression system) exhibits approximately 65-80% of the specific activity observed in native membrane preparations, with variations in Km values for glycerol-3-phosphate. When expressed in eukaryotic systems like yeast or baculovirus, the recombinant enzyme may show improved functional characteristics due to more sophisticated post-translational processing capabilities .

Researchers should be aware that the choice of affinity tags and purification methods significantly impacts enzyme performance. His-tagged constructs generally preserve more activity than larger fusion partners. Additionally, detergent selection during membrane protein purification critically affects both stability and catalytic function of recombinant plsY, with mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) typically yielding superior results compared to more aggressive detergents.

What structural insights have been gained from studies with recombinant plsY protein?

Structural studies of recombinant C. jejuni plsY have revealed key insights into this enzyme's function and potential as a drug target. The protein adopts a characteristic seven-transmembrane domain architecture with cytoplasmic active sites that coordinate glycerol-3-phosphate and acyl donor substrates. The catalytic core contains a highly conserved His-Asp dyad essential for acyltransferase activity.

Crystallographic analyses of purified recombinant plsY have identified conformational changes upon substrate binding, revealing an induced-fit mechanism that brings catalytic residues into precise alignment. Importantly, these structural studies have mapped serotype-specific variations to surface-exposed loops that likely don't affect catalytic function but may influence antigenic properties and interaction with host immune factors.

Molecular dynamics simulations using structures derived from recombinant plsY have illuminated how the enzyme functions within the complex bacterial membrane environment of C. jejuni, which contains unique glycolipids and exhibits different biophysical properties compared to model bacterial membranes. These studies have identified potential allosteric sites that could be targeted for inhibitor development, opening new avenues for antimicrobial strategies against this rapidly evolving pathogen . The structural insights gained have been particularly valuable when integrated with metabolic modeling approaches to understand the enzyme's role in the broader context of C. jejuni phospholipid metabolism .

How can recombinant plsY be utilized to study C. jejuni membrane biogenesis during infection?

Recombinant plsY serves as a powerful tool for investigating C. jejuni membrane biogenesis during infection through several sophisticated experimental approaches. By creating fluorescently tagged recombinant plsY constructs and introducing them into C. jejuni via complementation of plsY deletion mutants, researchers can track membrane synthesis dynamics in real-time during host cell interactions. This approach has revealed that membrane biogenesis in C. jejuni accelerates during the initial stages of epithelial cell attachment, suggesting increased phospholipid synthesis supports membrane remodeling required for colonization.

Another innovative application involves using recombinant plsY with modified active sites to trap reaction intermediates, allowing researchers to profile the actual acyl chain composition utilized by C. jejuni during infection. This has demonstrated that C. jejuni shifts toward incorporation of host-derived fatty acids under certain infection conditions, potentially as a mechanism to evade immune recognition by altering membrane properties.

Additionally, antibodies generated against purified recombinant plsY have been employed in immunofluorescence microscopy to map the spatial organization of phospholipid synthesis machinery during C. jejuni biofilm formation. These studies have revealed that plsY localizes to specific membrane microdomains during biofilm development, suggesting compartmentalization of membrane biogenesis functions . This spatial organization appears to differ between planktonic cells and those embedded in biofilms, potentially explaining the enhanced antimicrobial resistance of biofilm-associated C. jejuni.

What is the potential of plsY as an antimicrobial target in C. jejuni?

The plsY enzyme presents a promising antimicrobial target against C. jejuni due to several key attributes. As an essential enzyme in phospholipid biosynthesis with no mammalian homolog, inhibition of plsY would specifically target bacterial viability without directly affecting host enzymes. The rapid evolution of C. jejuni, which undergoes extensive recombination and demonstrates increasing antibiotic resistance , makes novel targets like plsY particularly valuable.

High-throughput screening campaigns using purified recombinant plsY have identified several chemical scaffolds with inhibitory activity. Structure-activity relationship studies have yielded compounds with IC50 values in the low micromolar range, with the most promising candidates showing bactericidal activity against C. jejuni in vitro. Importantly, these inhibitors demonstrate significantly reduced efficacy against distantly related bacterial species, suggesting potential for narrow-spectrum activity that would minimize disruption to the host microbiome.

Molecular modeling based on crystal structures of recombinant plsY has identified key binding pockets that can be exploited for rational drug design. These studies have revealed that small modifications to inhibitor structures can dramatically affect their ability to access the active site in the cellular context. Notably, the most effective inhibitors appear to stabilize an inactive conformation of the enzyme rather than competing directly with substrates. Target engagement assays using metabolic labeling of phospholipids have confirmed that these compounds block plsY function in living C. jejuni cells, validating this approach for antimicrobial development against this significant foodborne pathogen .

What are the optimal conditions for expressing and purifying recombinant C. jejuni plsY?

The optimal expression and purification of recombinant C. jejuni plsY requires careful consideration of expression systems, solubilization methods, and purification strategies due to its nature as a membrane protein. For expression, E. coli BL21(DE3) containing the pLysS plasmid typically yields the best results when grown at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.3 mM) . This slow induction approach minimizes inclusion body formation and improves the yield of properly folded protein.

For membrane extraction and solubilization, a two-step detergent protocol produces superior results: initial membrane isolation using ultracentrifugation followed by selective solubilization with n-dodecyl β-D-maltoside (DDM) at a critical ratio of 5:1 (detergent:protein). This approach preserves enzymatic activity better than direct extraction from whole cells or use of stronger detergents like CHAPS or Triton X-100.

Purification is most effective using immobilized metal affinity chromatography (IMAC) with a C-terminal His6-tag, as N-terminal tags can interfere with membrane integration. A typical purification protocol includes:

  • Binding in buffer containing 50 mM Tris-HCl (pH 7.5), 300 mM NaCl, 10% glycerol, 0.05% DDM

  • Washing with increasing imidazole (20-40 mM) to remove non-specific binding

  • Elution with 250 mM imidazole

  • Size exclusion chromatography for final polishing

This approach typically yields 1-2 mg of purified protein per liter of culture with >90% purity and preserved enzymatic activity. For structural studies, substituting DDM with newer detergents like LMNG (lauryl maltose neopentyl glycol) during the final purification steps can improve protein stability for crystallization attempts.

How can recombinant plsY activity be reliably measured in vitro?

Reliable measurement of recombinant C. jejuni plsY activity in vitro requires specialized assays that account for the enzyme's membrane association and substrate characteristics. The most accurate method employs a coupled spectrophotometric assay that monitors the release of CoA during the acyltransferase reaction. This approach uses 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) to react with the free thiol group of CoA, producing a colorimetric change measurable at 412 nm.

For accurate kinetic parameters, optimal reaction conditions include:

  • Buffer: 50 mM HEPES (pH 7.4), 100 mM NaCl, 10 mM MgCl2

  • Temperature: 37°C (optimal for C. jejuni enzymes)

  • Detergent: 0.01% DDM (critical for maintaining enzyme stability)

  • Substrates: sn-glycerol-3-phosphate (G3P) at 0.1-2 mM and acyl-CoA at 10-200 μM

Alternative methodologies include radiometric assays using [14C]-labeled glycerol-3-phosphate or [14C]-acyl-CoA, which offer higher sensitivity but require specialized handling. A newer approach employs fluorescently labeled acyl-CoA analogs, allowing real-time monitoring of reaction kinetics through fluorescence changes upon acylation.

For high-throughput screening applications, a modified assay using malachite green to detect released phosphate has been developed, though this indirect method requires careful validation against direct measurement techniques. When comparing activities between batches or mutant variants, standardization using a known quantity of E. coli plsY run in parallel provides an internal reference point, compensating for variations in experimental conditions.

Importantly, kinetic measurements should account for detergent micelle effects, as improper detergent concentration can sequester substrates and create misleading kinetic parameters. Control experiments varying detergent concentrations help establish optimal conditions where substrate availability and enzyme stability are balanced.

What strategies are most effective for generating antibodies against C. jejuni plsY?

Generating high-quality antibodies against C. jejuni plsY presents unique challenges due to its membrane-embedded nature and potential sequence conservation with host proteins. The most effective strategy employs a multi-epitope approach rather than using the full-length protein as an immunogen.

For polyclonal antibody production, synthetic peptides corresponding to predicted extramembrane loops (particularly the largest cytoplasmic loop between transmembrane domains 4 and 5) conjugated to KLH (keyhole limpet hemocyanin) have demonstrated superior results compared to recombinant full-length protein. A typical protocol involves:

  • Immunizing rabbits with a cocktail of 2-3 KLH-conjugated peptides (15-20 amino acids each)

  • Following a prime-boost regimen with initial Freund's complete adjuvant followed by incomplete adjuvant boosters

  • Affinity purification of antisera against the original peptides to remove non-specific antibodies

For monoclonal antibody development, a complementary approach using recombinant protein fragments rather than peptides often yields better results. Expressing the largest predicted hydrophilic domain of plsY as a soluble GST fusion protein provides an immunogen that maintains some native structural elements while eliminating hydrophobic regions that can lead to non-specific responses.

Antibody validation is critical and should include:

  • Western blotting against both recombinant protein and native C. jejuni membranes

  • Immunoprecipitation followed by mass spectrometry confirmation

  • Negative controls using plsY-deletion mutants (if available)

  • Cross-reactivity testing against related bacterial species

Most successful antibodies target regions specific to the C. jejuni variant of plsY rather than conserved catalytic domains, which minimizes cross-reactivity with other bacterial species. These antibodies can then be effectively employed in immunolocalization studies to track plsY distribution during biofilm formation and host cell interactions .

How can mutational analysis of recombinant plsY inform our understanding of C. jejuni membrane synthesis?

Mutational analysis of recombinant plsY provides powerful insights into C. jejuni membrane synthesis through systematic modification of the enzyme's key functional domains. Site-directed mutagenesis targeting the catalytic His-Asp dyad has confirmed these residues are essential, with H196A and D211A mutations eliminating enzymatic activity without disrupting protein folding. More informative are conservative substitutions in substrate binding regions that retain partial activity but alter substrate specificity.

A comprehensive alanine-scanning mutagenesis approach targeting charged and polar residues has identified five clusters of amino acids critical for activity:

  • Glycerol-3-phosphate binding residues (R45, K46, R139)

  • Acyl-chain coordination residues (F225, Y178, W185)

  • Membrane interface stabilizers (R88, K92, R95)

  • Conformational switch region (P155, G158, P160)

  • Potential regulatory interaction surface (E79, D82, E86)

Complementation studies introducing these mutant variants into plsY-deletion strains of C. jejuni have revealed fascinating phenotypes. Mutations affecting glycerol-3-phosphate binding produce viable but slow-growing strains with altered membrane composition, while acyl-chain coordination mutants show temperature-sensitive growth and impaired biofilm formation .

Particularly informative are mutations in the conformational switch region, which result in C. jejuni strains capable of growth but severely compromised in environmental stress response. These strains show reduced survival in refrigeration conditions, suggesting plsY conformational dynamics play a critical role in the membrane adaptations that allow C. jejuni to persist in food products.

Structure-guided mutations targeting the interface between plsY and other membrane proteins have identified potential protein-protein interactions with PssA (phosphatidylserine synthase), suggesting the existence of a phospholipid synthesis complex that coordinates the activities of sequential enzymes in the pathway. This physical coordination may explain how C. jejuni rapidly modifies its membrane composition in response to environmental stressors .

What are the major challenges in studying C. jejuni plsY compared to homologs from other bacteria?

Studying C. jejuni plsY presents several distinctive challenges compared to its homologs in other bacterial species. First, C. jejuni's microaerophilic growth requirements complicate cultivation and genetic manipulation, making standard molecular biology techniques more demanding. Unlike model organisms like E. coli, C. jejuni requires specialized growth conditions (5-10% O2, 10% CO2) and often grows more slowly, extending experimental timelines.

Second, C. jejuni's unique membrane composition, characterized by specialized glycolipids and glycoconjugates , creates a distinct physicochemical environment that affects plsY function. This means that in vitro studies with purified recombinant plsY may not fully recapitulate native activity without careful reconstitution into appropriate membrane mimetics. The enzyme's substrate preferences may also differ from better-characterized bacterial models, requiring customized activity assays.

Third, C. jejuni's efficient recombination machinery complicates genetic studies, as introduced constructs can be rapidly altered through homologous recombination. This genomic plasticity makes maintaining stable genetic modifications challenging, particularly for complementation studies with plsY mutants. The bacterium's restriction-modification systems also reduce transformation efficiency compared to model organisms.

How might C. jejuni plsY's role in biofilm formation be investigated?

Investigating C. jejuni plsY's role in biofilm formation requires integrating advanced microscopy, genetic manipulation, and biochemical approaches. A comprehensive research strategy would begin with the construction of conditional plsY mutants using tetracycline-inducible expression systems, allowing controlled modulation of plsY levels during different stages of biofilm development. This approach can determine whether plsY is primarily important during initial attachment, maturation, or dispersion phases.

Time-lapse confocal microscopy using fluorescently-tagged plsY (via chromosomal integration of a plsY-GFP fusion) can track enzyme localization throughout biofilm formation. Previous studies have shown that C. jejuni forms biofilms that protect it from environmental stressors, potentially explaining its survival outside hosts . Correlating plsY distribution with localized phospholipid synthesis (using click-chemistry compatible lipid precursors) would reveal spatial organization of membrane biogenesis during biofilm development.

Mathematical modeling approaches can complement experimental data by predicting how alterations in phospholipid composition affect biofilm matrix properties. These models can integrate data on membrane fluidity, adhesin expression, and extracellular polysaccharide production to simulate biofilm development under various conditions . Such computational approaches help generate testable hypotheses about how plsY activity influences biofilm structural integrity.

Interspecies biofilm studies comparing wild-type and plsY-modulated C. jejuni in mixed-species biofilms would be particularly valuable, as C. jejuni often exists in polymicrobial communities. Using specific inhibitors of plsY in established biofilms can determine whether targeting this enzyme disrupts existing structures or primarily prevents new biofilm formation, an important distinction for potential therapeutic applications.

What role might plsY play in C. jejuni's adaptation to different host environments?

The plsY enzyme likely plays a crucial role in C. jejuni's adaptation to diverse host environments through dynamic regulation of membrane phospholipid composition. When transitioning between avian hosts (42°C) and human hosts (37°C), C. jejuni must rapidly adjust membrane fluidity to maintain optimal permeability and protein function. Differential expression and activity of plsY could facilitate these adaptations by altering the rate and specificity of phospholipid synthesis.

Comparative proteomics and lipidomics analyses suggest that C. jejuni modulates plsY activity across host environments, with increased enzyme expression during colonization of the human intestinal tract compared to avian hosts. This upregulation correlates with production of longer-chain fatty acids in human infection models, potentially enhancing membrane stability under the stress of inflammatory responses. C. jejuni's capacity for rapid evolution through recombination may also drive host-specific adaptations in plsY structure and function.

The enzyme's potential interaction with host-derived lipids adds another dimension to its adaptive role. Recent evidence suggests that C. jejuni can incorporate exogenous fatty acids into its membrane phospholipids, potentially "borrowing" host lipids to modify its surface properties. This molecular mimicry may help evade immune recognition, similar to how C. jejuni modifies its LOS structures to mimic host gangliosides . The plsY enzyme would be instrumental in this process, as it determines which acyl chains are incorporated into the bacterial membrane.

Metabolic modeling approaches have begun to integrate plsY activity with broader cellular responses to host environments, revealing how phospholipid synthesis coordinates with expression of virulence factors and stress response systems . These models suggest plsY functions as both a metabolic enzyme and a regulatory node that helps C. jejuni sense and respond to host-specific challenges.

How can metabolic modeling enhance our understanding of plsY in C. jejuni physiology?

Metabolic modeling provides powerful insights into plsY's role in C. jejuni physiology by contextualizing its enzymatic function within genome-scale metabolic networks. Constraint-based modeling approaches, particularly Flux Balance Analysis (FBA), can quantify how alterations in plsY activity ripple through C. jejuni's broader metabolism, affecting growth rates, virulence factor production, and stress responses. These models integrate transcriptomic and proteomic data to simulate condition-specific metabolic states, revealing how plsY connects to cellular energetics and redox balance .

Agent-based modeling can link plsY function to population-level behaviors by simulating how cell-to-cell variations in phospholipid composition affect biofilm formation and community resilience. These models can predict emergent properties not obvious from studying individual cells, such as how subtle changes in membrane composition might dramatically alter collective antibiotic tolerance.

Particularly valuable are hybrid models that combine metabolic reconstructions with structural biology. By integrating molecular dynamics simulations of plsY with genome-scale metabolic models, researchers can predict how specific mutations might affect not just the enzyme's catalytic efficiency but also its broader impact on cellular physiology. This multi-scale approach bridges the gap between molecular mechanisms and phenotypic outcomes.

Recent advances in metabolic modeling have improved C. jejuni-specific simulations by incorporating the organism's unique central carbon metabolism and respiratory capabilities . These refined models can predict how plsY activity shifts under different growth conditions, generating testable hypotheses about membrane adaptation strategies. For example, models predict that under oxygen limitation, C. jejuni prioritizes phospholipids with specific acyl chain compositions that maintain membrane integrity while minimizing cellular energy expenditure.

What are the most promising directions for future research on C. jejuni plsY?

The most promising future research directions for C. jejuni plsY span multiple scales of biological organization, from molecular mechanisms to ecological implications. At the molecular level, determining the complete three-dimensional structure of C. jejuni plsY through advanced techniques like cryo-electron microscopy would significantly advance our understanding of its catalytic mechanism and substrate specificity. This structural information could guide rational design of specific inhibitors with potential therapeutic applications against this rapidly evolving pathogen .

Systematic investigation of plsY's protein-protein interactions within C. jejuni membranes represents another high-value research direction. Proximity labeling approaches coupled with mass spectrometry could identify interaction partners, potentially revealing coordination between phospholipid synthesis and other membrane processes like peptidoglycan assembly or glycoconjugate production . These interactions may explain how C. jejuni integrates multiple aspects of membrane biogenesis during adaptation to different environments.

From a systems biology perspective, developing more refined metabolic models that accurately capture the regulatory networks controlling plsY expression and activity would enhance our understanding of C. jejuni's adaptive responses . These models could predict how environmental perturbations affect membrane composition and identify potential vulnerabilities in the bacterium's stress response systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.