Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction and Classification

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Lipoprotein signal peptidase (lspA) is a recombinant protein derived from the bacterial pathogen Campylobacter jejuni (strain RM1221). It belongs to the family of lipoprotein signal peptidases (SPases), specifically functioning as SPase II, which processes prolipoproteins by cleaving their signal peptides. This enzyme is critical for the maturation of bacterial lipoproteins, which are anchored to the membrane and play roles in structural integrity, adhesion, and virulence .

Notable features:

  • Signal peptide: The N-terminal sequence contains a hydrophobic core (e.g., VLFALDQWV) followed by a cleavage site recognized by SPase II.

  • Catalytic domain: The C-terminal region includes motifs (e.g., DRFIHGGVVDMFF) conserved in SPase II enzymes, which facilitate enzymatic activity .

2.2. Enzymatic Activity

lspA processes prolipoproteins by removing their signal peptides, enabling proper anchoring to the bacterial membrane. This activity is essential for:

  1. Lipoprotein maturation: Ensuring correct folding and localization of lipoproteins.

  2. Membrane integrity: Lipoproteins constitute ~20% of bacterial membrane proteins, critical for structural stability .

3.1. General Importance

As a SPase II, lspA is indispensable for the maturation of lipoproteins, including those involved in:

  • Adhesion: Lipoproteins like JlpA (a surface-exposed adhesin) require proper processing for host-cell interaction .

  • Toxin secretion: Lipoproteins may assist in the transport of virulence factors (e.g., via secretion systems) .

4.1. Recombinant Production

lspA is produced recombinantly for biochemical and immunological studies. Key production details include:

ParameterDescription
Host SystemTypically E. coli (BL21(DE3) or similar systems)
PurificationTris-based buffer with 50% glycerol; storage at -20°C or -80°C
StabilityAvoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week

4.2. Experimental Uses

  • Enzymatic assays: Studying prolipoprotein processing kinetics.

  • Vaccine development: Lipoproteins are targets for subunit vaccines; lspA may inform antigen design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Cj0361; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
lspA
Target Protein Sequence
MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGFRWQSEYLDLTYALNTGVAFSMLSFLEH NLKYLHLALIGVLFIYLFWQRTLLKTHSIAFGMMLGAGVSNLLDRFIHGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: cje:Cj0361

STRING: 192222.Cj0361

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni and why is it significant for microbiological research?

Campylobacter jejuni is a Gram-negative, spiral-shaped, non-spore-forming, microaerophilic bacterium that forms motile rods with a single polar flagellum. This pathogen is one of the most common causes of bacterial gastroenteritis globally, making it a significant public health concern . C. jejuni naturally colonizes the digestive tract of many bird species, particularly poultry, which serves as a major reservoir for human infection . When exposed to atmospheric oxygen, C. jejuni can transform into a coccal form, demonstrating its adaptive capabilities in different environmental conditions . The significance of C. jejuni in research stems from its complex pathogenesis mechanisms, its burden on global health systems, and the emerging recognition of chronic health consequences attributed to this pathogen beyond acute gastroenteritis .

What is lipoprotein signal peptidase (lspA) and what fundamental role does it play in bacterial physiology?

Lipoprotein signal peptidase (LspA), also known as signal peptidase II, is a crucial enzyme in the lipoprotein processing pathway of bacteria. In the lipoprotein biogenesis pathway, LspA cleaves amino acids preceding the cysteine of prolipoproteins, resulting in diacylated apolipoproteins . This post-translational modification is essential for proper lipoprotein function and localization within the bacterial cell. Research with related Epsilonproteobacteria (such as Helicobacter pylori) has demonstrated that lspA is essential for bacterial growth and survival . The fundamental importance of lspA lies in its role in bacterial cell envelope integrity, protein transport, nutrient acquisition, and cell signaling—all critical aspects of bacterial physiology and pathogenesis.

How are serotypes of Campylobacter jejuni classified and what distinguishes serotype O:2?

Campylobacter jejuni serotypes are primarily classified based on the Penner heat-stable (HS) serotyping scheme, which is determined by capsular polysaccharide (CPS) antigens . To date, 47 Penner serotypes have been identified, with serotype O:2 being one of the clinically relevant serotypes. The serotype classification is significant because different serotypes may exhibit variations in virulence, host specificity, antibiotic resistance patterns, and geographical distribution. For experimental research, serotype determination requires antisera raised against heat-stable C. jejuni antigens and involves agglutination techniques or molecular methods targeting the genes responsible for capsular synthesis. When conducting research with serotype O:2, it's essential to consider how the specific capsular structure might influence pathogenesis, immune evasion, and potential vaccine development strategies.

What laboratory techniques are essential for expression and purification of recombinant lspA protein?

For successful expression and purification of recombinant Campylobacter jejuni lspA protein, researchers typically employ the following methodological approach:

  • Expression system selection: Common expression systems include E. coli, yeast, baculovirus, or mammalian cell systems . E. coli is often preferred for its simplicity and high yield, but membrane proteins like lspA may require eukaryotic systems for proper folding.

  • Vector design: The lspA gene sequence should be optimized for the chosen expression system, including codon optimization and addition of appropriate tags (e.g., His-tag) for purification.

  • Expression conditions: Optimization of induction parameters (temperature, inducer concentration, duration) is critical, with lower temperatures (16-25°C) often favoring proper folding of membrane proteins.

  • Membrane protein extraction: Since lspA is a membrane-associated protein, specialized extraction protocols using detergents (e.g., sodium deoxycholate) are necessary to solubilize the protein while maintaining its native structure .

  • Purification strategy: Typically involves affinity chromatography (if tagged), followed by size exclusion and/or ion exchange chromatography to achieve high purity.

  • Functional verification: Activity assays to confirm that the purified lspA retains its peptidase function, typically using synthetic peptide substrates.

When working with recombinant lspA from C. jejuni serotype O:2 specifically, researchers should consider strain-specific sequence variations that might affect protein expression, folding, or function.

How can complementation studies be designed to investigate lspA essentiality in Campylobacter jejuni?

Investigating the essentiality of lspA in Campylobacter jejuni requires sophisticated genetic approaches due to the challenges in manipulating this microaerophilic organism. Based on studies with related bacteria, the following methodological framework is recommended:

  • Conditional mutant construction: Create a C. jejuni strain where the native lspA gene is under the control of an inducible promoter. This allows for controlled expression of lspA and assessment of phenotypic changes upon depletion.

  • Heterologous complementation: As demonstrated with Helicobacter pylori, where lspA homologs could complement conditionally lethal E. coli mutant strains , researchers can test whether C. jejuni lspA can functionally replace lspA in other bacterial species.

  • Complementation construct design: For in trans complementation, the lspA gene should be cloned into a suitable shuttle vector with a constitutive or inducible promoter. Include epitope tags if antibodies against native lspA are unavailable.

  • Phenotypic analysis: Upon lspA depletion, assess multiple parameters including:

    • Growth kinetics in various media conditions

    • Cell morphology (via microscopy)

    • Membrane integrity (using membrane-impermeable dyes)

    • Lipoprotein processing (via proteomics or Western blotting)

    • Stress response activation

  • Rescue experiments: Test whether the growth defect can be rescued by supplementation with processed lipoproteins or membrane-stabilizing agents.

These approaches can provide definitive evidence regarding the essentiality of lspA in C. jejuni, as has been demonstrated for Helicobacter pylori where lspA was found to be essential for growth .

What methodologies are most effective for studying the structure-function relationship of lspA in Campylobacter jejuni?

Elucidating the structure-function relationship of C. jejuni lspA requires a multidisciplinary approach combining structural biology, biochemistry, and molecular genetics:

  • Structural determination:

    • X-ray crystallography of purified recombinant lspA (challenging due to membrane association)

    • Cryo-electron microscopy for membrane-embedded visualization

    • NMR spectroscopy for dynamic elements analysis

    • Computational modeling based on homologous proteins with known structures

  • Site-directed mutagenesis:

    • Systematic mutation of conserved catalytic residues and subsequent activity assays

    • Creation of chimeric proteins with lspA regions from other bacterial species

    • Insertion of reporter tags at various positions to monitor protein topology

  • Substrate specificity analysis:

    • In vitro cleavage assays using synthetic peptides mimicking various lipoprotein signal sequences

    • Proteomic identification of all lspA substrates (the "lspA-dependent lipoproteome")

    • Competition assays to determine substrate preference hierarchy

  • Inhibitor studies:

    • Testing known lspA inhibitors (e.g., globomycin) on C. jejuni lspA

    • Structure-activity relationship studies with modified inhibitors

    • Development of C. jejuni lspA-specific inhibitors

  • Interaction studies:

    • Co-immunoprecipitation to identify protein interaction partners

    • Bacterial two-hybrid assays to verify direct interactions

    • Lipidomic analysis to determine lipid environment preferences

These methodologies provide complementary data sets that, when integrated, can reveal the structural determinants of lspA activity and specificity in C. jejuni.

How does lspA function in Campylobacter jejuni compare to its homologs in other Epsilonproteobacteria?

Comparative analysis of lspA function across Epsilonproteobacteria reveals important insights into evolutionary conservation and specialization:

FeatureC. jejuni lspAH. pylori lspAOther Epsilonproteobacteria
EssentialityLikely essential (inferred)Essential for growth Variable
Genetic contextOften in operons with other lipoprotein processing genesSimilar operon structure Less conserved
Substrate rangeBroad (predicted)Includes virulence factors like CagT Species-specific
Inhibitor sensitivityNot well characterizedSensitive to canonical inhibitorsVariable
Complementation abilityCan likely complement other speciesCan complement E. coli lspA mutants Species-dependent

The comparative analysis of lspA function should consider several methodological approaches:

  • Heterologous expression studies: Testing whether lspA from different Epsilonproteobacteria can functionally substitute for each other.

  • Phylogenetic analysis: Constructing evolutionary trees based on lspA sequences to identify conserved and divergent regions that may reflect functional specialization.

  • Substrate processing assays: Comparing the efficiency and specificity with which lspA from different species processes various lipoprotein substrates.

  • Structural modeling: Identifying structural differences that might account for functional variations between species.

Research with H. pylori has demonstrated that lspA is part of a conserved lipoprotein processing pathway that includes lgt and lnt, though there are significant divergences from canonical pathways found in model proteobacteria . This suggests that C. jejuni lspA likely has both conserved and species-specific functions within the Epsilonproteobacteria class.

What role does lspA play in Campylobacter jejuni pathogenesis and host interaction?

The role of lspA in C. jejuni pathogenesis is multifaceted and can be investigated through several experimental approaches:

  • Virulence factor processing: Similar to H. pylori, where lipidation of the VirB7 homolog CagT was shown to be essential for Cag T4SS function , C. jejuni lspA likely processes key virulence-associated lipoproteins. Identifying these substrates through proteomics after lspA inhibition or depletion can reveal pathogenesis mechanisms.

  • Host immune recognition: Bacterial lipoproteins are potent stimulators of innate immunity through Toll-like receptor 2 (TLR2). Experimental approaches to study this include:

    • Comparing cytokine responses to wild-type versus lspA-depleted C. jejuni in cell culture and animal models

    • Assessing TLR2 activation using reporter cell lines

    • Evaluating dendritic cell maturation and antigen presentation

  • Colonization factors: Many bacterial adhesins and colonization factors are lipoproteins. Researchers can use colonization models (e.g., chicken models, as C. jejuni naturally colonizes the avian digestive tract ) to assess how lspA inhibition affects bacterial persistence and spread.

  • Stress response and adaptation: lspA-processed lipoproteins may be involved in adaptation to host environments. This can be tested by exposing lspA-depleted C. jejuni to various host-relevant stressors (bile salts, pH changes, osmotic stress) and measuring survival.

  • Vaccine development implications: Given that bacterial lipoproteins are often immunodominant antigens, understanding lspA's role in processing these potential vaccine candidates is crucial for vaccine development efforts, similar to the approaches being taken with C. jejuni capsular polysaccharide conjugate vaccines like CJCV1 and CJCV2 .

Through these approaches, researchers can elucidate how lspA contributes to C. jejuni's remarkable ability to cause widespread human illness despite being highly susceptible to environmental stresses outside its preferred niches.

What novel approaches can be applied to develop lspA inhibitors as potential therapeutic agents against Campylobacter infection?

Development of lspA inhibitors represents a promising therapeutic strategy given the enzyme's essential role in bacterial physiology. The following methodological approaches can be employed:

  • High-throughput screening (HTS):

    • Development of fluorescence-based assays for lspA activity

    • Screening of chemical libraries against purified recombinant C. jejuni lspA

    • Phenotypic screening using growth inhibition of C. jejuni as a readout

  • Structure-based drug design:

    • Using structural data (experimental or homology models) to identify the catalytic pocket

    • In silico docking studies to identify potential binding molecules

    • Fragment-based approaches to build inhibitors with high specificity

  • Known inhibitor optimization:

    • Modification of known lspA inhibitors (e.g., globomycin) to enhance activity against C. jejuni lspA

    • Structure-activity relationship studies to identify critical chemical moieties

    • Lipidomimetic approaches to create competitive inhibitors

  • Evaluation criteria for candidate inhibitors:

    • Potency against C. jejuni lspA (IC50 values)

    • Selectivity over human peptidases

    • Antimicrobial activity against C. jejuni (MIC values)

    • Activity in infection models (cell culture and animal)

    • Pharmacokinetic and safety profiles

  • Combination therapy approaches:

    • Testing lspA inhibitors in combination with existing antibiotics

    • Evaluating synergistic effects with host defense peptides

    • Exploring delivery systems to enhance inhibitor access to bacteria

The development of lspA inhibitors must consider the unique challenges of C. jejuni, including its microaerophilic nature and distinctive cell envelope structure. The potential therapeutic application of such inhibitors would be particularly valuable given the rising antibiotic resistance in Campylobacter species and the need for targeted treatment approaches that minimize disruption of the commensal microbiota.

How can CRISPR-Cas9 technology be applied to study lspA function in Campylobacter jejuni?

CRISPR-Cas9 technology offers revolutionary approaches for genetic manipulation of bacterial systems, including Campylobacter jejuni. For studying lspA function, researchers can implement the following methodological strategies:

  • Inducible CRISPR interference (CRISPRi) system:

    • Design of guide RNAs targeting lspA promoter or non-catalytic regions

    • Construction of an inducible dCas9 expression system compatible with C. jejuni

    • Titration of lspA expression levels to identify minimal requirements for growth

    • Real-time monitoring of cellular effects during lspA depletion

  • Precise genetic modification:

    • Introduction of point mutations in catalytic residues to create hypomorphic alleles

    • Addition of epitope tags for in vivo tracking of lspA localization

    • Engineering of substrate specificity by targeted modification of binding domains

    • Creation of temperature-sensitive alleles for conditional function studies

  • Genomic context analysis:

    • Systematic deletion of genes in the genomic neighborhood of lspA

    • Assessment of genetic interactions using CRISPR-based double-knockout screens

    • Identification of synthetic lethal interactions with lspA

  • Base editing approaches:

    • Use of CRISPR base editors to introduce premature stop codons or amino acid changes without double-strand breaks

    • Creation of libraries of lspA variants to screen for functional domains

When implementing CRISPR-Cas9 in C. jejuni, researchers must address specific challenges including efficiency of transformation, specificity of guide RNAs in the AT-rich genome, and optimization of Cas9 expression in this microaerophilic organism. Despite these challenges, CRISPR-based approaches offer unprecedented precision for dissecting lspA function in its native context.

What proteomics approaches can reveal the complete set of lspA substrates in Campylobacter jejuni serotype O:2?

Comprehensive identification of lspA substrates requires sophisticated proteomics approaches tailored to bacterial lipoproteins:

  • Comparative membrane proteomics:

    • Comparison of membrane proteomes from wild-type and lspA-depleted C. jejuni

    • Identification of proteins with altered membrane association or processing

    • Quantitative analysis using SILAC or TMT labeling

    • Detection of signal peptide remnants in lspA-deficient conditions

  • Acyl-biotin exchange (ABE) methodology:

    • Selective biotinylation of lipid-modified proteins

    • Streptavidin pull-down followed by mass spectrometry

    • Differentiation between types of lipid modifications

    • Comparison across growth conditions to identify regulated lipoproteins

  • Metabolic labeling approaches:

    • Incorporation of alkyne/azide-modified fatty acids into lipoproteins

    • Click chemistry-based enrichment of labeled proteins

    • Direct visualization of lipoproteins using fluorescent tags

    • Pulse-chase experiments to determine lipoprotein turnover rates

  • Integration with bioinformatics:

    • Prediction of lipoprotein signal sequences in the C. jejuni serotype O:2 genome

    • Verification of predicted lipoproteins by proteomics

    • Analysis of lipoprotein conservation across Campylobacter strains and serotypes

    • Functional classification of identified lipoproteins

These approaches can generate a comprehensive "lipoproteome" map for C. jejuni serotype O:2, providing insights into the full range of cellular processes dependent on lspA activity. The methodological workflow should include rigorous validation steps, as lipoproteins can be challenging to detect due to their hydrophobicity and membrane association. The resulting dataset would be valuable for understanding both conserved and serotype-specific aspects of C. jejuni biology.

How do phase variations in Campylobacter jejuni affect lspA function and its substrate specificity?

Phase variation, a high-frequency genetic mechanism in C. jejuni involving slipped-strand mispairing in C/G-rich regions , may impact lspA function and substrate processing in complex ways:

  • Direct phase variation of lspA:

    • Analysis of C. jejuni lspA sequence for poly-C/G tracts capable of phase variation

    • Monitoring of lspA expression across bacterial populations using reporter constructs

    • Single-cell analysis techniques to detect heterogeneity in lspA expression

    • Assessment of growth and fitness consequences of lspA phase variation

  • Phase variation of lspA substrates:

    • Identification of phase-variable lipoproteins in the C. jejuni genome

    • Characterization of how phase-ON versus phase-OFF states affect lipoprotein processing

    • Development of methods to detect partially processed lipoproteins

  • Experimental approaches:

    • Creation of "locked" mutants (phase-ON or phase-OFF) for key phase-variable lipoproteins

    • Comparative proteomics between phase variants

    • In vitro processing assays using substrate peptides with sequence variations

    • Cross-linking studies to capture transient enzyme-substrate interactions

  • Functional implications:

    • Assessment of how phase variation affects membrane structure and function

    • Investigation of phase variation's role in immune evasion through altered lipoprotein display

    • Evaluation of contributions to antibiotic resistance and stress response

Similar to the MeOPN modification in C. jejuni CPS, which exhibits phase variation through poly(C) tracts , phase-variable lipoproteins processed by lspA may contribute to bacterial adaptation to different host environments. This research direction connects the fundamental molecular mechanisms of phase variation with the functional consequences for bacterial physiology and host interaction.

How can recombinant lspA be utilized in Campylobacter vaccine development strategies?

Recombinant lspA offers several promising avenues for Campylobacter vaccine development:

  • As a vaccine antigen:

    • Assessment of immunogenicity of recombinant lspA in animal models

    • Epitope mapping to identify protective B and T cell epitopes

    • Design of chimeric antigens combining lspA epitopes with other immunogenic components

    • Evaluation of cross-protection against diverse C. jejuni serotypes

  • As a processing tool for lipoprotein-based vaccines:

    • In vitro processing of recombinant lipoproteins for enhanced immunogenicity

    • Co-expression systems for lipoprotein modification during vaccine production

    • Quality control of lipoprotein-based vaccine candidates

  • As a target for attenuated live vaccines:

    • Development of C. jejuni strains with regulated lspA expression for controlled attenuation

    • Engineering of substrate specificity to modify pathogen-host interactions

    • Safety and immunogenicity testing in appropriate animal models

  • Integration with existing vaccine platforms:

    • Potential incorporation into capsular polysaccharide conjugate vaccine approaches like CJCV1 and CJCV2

    • Comparison of vaccine formulations with adjuvants such as aluminum hydroxide

    • Optimization of dosing schedules based on CJCV vaccine trials (2-dose schedule, 4 weeks apart)

ApproachAdvantagesChallengesKey Considerations
Recombinant lspA as antigenHighly conserved across strainsPotential toxicity, solubility issuesRequires appropriate adjuvants
lspA-processed lipoproteinsNatural TLR2 agonist activityHeterogeneity of processed productsSelection of immunodominant lipoproteins
Attenuated lspA mutantsMimics natural infectionSafety concerns, regulatory hurdlesBalance between attenuation and immunogenicity
Integration with CPS conjugatesCombines B and T cell epitopesComplex manufacturing processCarrier protein selection (e.g., CRM197)

The development of Campylobacter vaccines remains a priority given the substantial disease burden globally and the emerging recognition of chronic health consequences associated with Campylobacter infection . Recombinant lspA-based approaches could complement existing vaccine strategies like the CJCV candidates currently under development.

What are the implications of lspA research for understanding antimicrobial resistance in Campylobacter jejuni?

Research on lspA has significant implications for antimicrobial resistance (AMR) in Campylobacter jejuni:

  • Direct role in resistance mechanisms:

    • Investigation of lspA-processed lipoproteins involved in drug efflux systems

    • Analysis of membrane integrity alterations affecting antibiotic penetration

    • Characterization of lspA's role in stress responses that contribute to antibiotic tolerance

  • As an antimicrobial target:

    • Assessment of selective pressure on lspA during antibiotic exposure

    • Identification of natural polymorphisms that might affect inhibitor binding

    • Development of lspA inhibitors as novel antimicrobials with reduced resistance potential

  • Methodological approaches:

    • Transcriptomic analysis of lspA and lipoprotein genes during antibiotic exposure

    • Creation of laboratory-evolved resistant strains followed by lspA pathway analysis

    • Systematic testing of lspA inhibitors in combination with conventional antibiotics

    • Genetic screens for interactions between lspA and known resistance determinants

  • Clinical relevance:

    • Correlation studies between lspA variants and clinical resistance patterns

    • Assessment of lipoprotein processing in patient-derived resistant isolates

    • Evaluation of lspA inhibitors against multidrug-resistant clinical isolates

The essential nature of lspA for bacterial growth makes it an attractive antimicrobial target with potentially lower resistance development risk compared to targets with redundant pathways. Furthermore, targeting a conserved cellular process like lipoprotein processing may provide activity against Campylobacter strains with diverse resistance mechanisms to conventional antibiotics.

How can systems biology approaches integrate lspA function into the broader context of Campylobacter jejuni cellular networks?

Systems biology offers powerful frameworks to contextualize lspA function within the complex cellular networks of Campylobacter jejuni:

  • Multi-omics integration:

    • Combined analysis of transcriptomics, proteomics, and lipidomics data from lspA perturbation experiments

    • Correlation of lspA expression with global cellular responses across diverse conditions

    • Identification of compensatory mechanisms activated upon lspA inhibition

    • Network modeling to predict systems-level consequences of lspA dysfunction

  • Genome-scale models:

    • Incorporation of lipoprotein processing into metabolic and protein secretion models

    • Flux balance analysis to predict growth phenotypes of lspA perturbations

    • In silico prediction of genetic interactions and synthetic lethality

    • Model refinement through experimental validation

  • Protein-protein interaction networks:

    • Mapping the interactome of lspA and its processed lipoproteins

    • Identification of functional modules dependent on lipoprotein processing

    • Temporal dynamics of interaction networks during infection processes

    • Comparative interactomics across Campylobacter strains and related species

  • Host-pathogen systems biology:

    • Modeling how lspA-dependent processes influence host cell responses

    • Integration of bacterial and host transcriptomics during infection

    • Prediction of host targets for intervention based on network analysis

    • Identification of critical nodes in combined host-pathogen networks

Systems biology approaches can reveal emergent properties not discernible through reductionist approaches, such as compensatory pathways, feedback loops, and condition-specific dependencies. For lspA research, these methods can help prioritize experimental directions, identify unexpected connections between cellular processes, and provide a holistic understanding of how this essential enzyme contributes to C. jejuni physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.