Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
corA; Cj0726c; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
corA
Target Protein Sequence
MLYIYIKTQNALVQRINFNLDSQELPQNILWIDLLHPSAAEIAFISSEFNLEFPTKEERE EIELSAKYWEDNATITINAHFLVRDLKSDEEDRNLIKLRTEIVTFATAKNILFTIRYNEF STFEEIQARILASPKNFEDGFDIIDKMFEVRVEKDADLLEWIDKEARRLRTSVLEKKDEY SYDEMLKDISSLQELNMRVRDSLFDKRRAMTSLLKSDKIDKDIKQNLTIVLKDLNSLVEF SVSQLNILDNIQTILASQINIEQNKVIKIFTVATVAMMPPTLIGTVYGMNFKFMPELELH YAYPIVLGVMVISIILPLVVFKKKGWL
Uniprot No.

Target Background

Function

This protein mediates the influx of magnesium ions and can also mediate cobalt and manganese uptake. It functions by alternating between open and closed states, activated by low cytoplasmic Mg2+ levels and inactivated by high cytoplasmic Mg2+ levels.

Database Links

KEGG: cje:Cj0726c

STRING: 192222.Cj0726c

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of C. jejuni CorA protein and how does it differ from other bacterial CorA proteins?

Methodology for structural determination: X-ray crystallography combined with circular dichroism spectroscopy and size-exclusion chromatography can be employed to determine the structural characteristics of recombinant cjCorA proteins. These techniques allow researchers to visualize the three-dimensional structure and examine the conformation changes induced by divalent cation binding.

How essential is CorA for C. jejuni survival and growth?

CorA plays a critical role in C. jejuni survival as it serves as the primary magnesium transporter. Experimental evidence from knockout studies shows that corA mutants cannot grow without Mg²⁺ supplementation (20 mM), demonstrating that Mg²⁺ acquisition through CorA is essential for C. jejuni growth in vitro. This phenotype suggests that CorA might be the only functional Mg²⁺ transport system in C. jejuni and likely plays a key role in adaptation to low-Mg²⁺ environments, such as the gut .

Methodological approach: To assess CorA essentiality, researchers typically use allelic exchange to inactivate the corA gene and then evaluate growth characteristics with and without magnesium supplementation. Growth curves at various Mg²⁺ concentrations (5 mM, 10 mM, 20 mM) can be measured to determine the minimum concentration required for mutant survival.

What are the optimal conditions for expressing recombinant C. jejuni CorA protein?

For optimal expression of recombinant C. jejuni CorA, E. coli expression systems using vectors such as pET or pGEX are commonly employed. The full-length protein presents challenges due to its transmembrane domains, so researchers often express the cytoplasmic domain separately for structural and biochemical studies. Expression is typically performed at lower temperatures (16-20°C) after IPTG induction to enhance protein folding and solubility.

Recommended methodology:

  • Clone the corA gene or cytoplasmic domain into an expression vector containing a purification tag (His, GST)

  • Transform into E. coli BL21(DE3) or similar expression strains

  • Grow cultures to mid-log phase (OD₆₀₀ of 0.6-0.8)

  • Induce with 0.1-0.5 mM IPTG

  • Express at 18°C for 16-20 hours to maximize soluble protein yield

  • Supplement growth media with 10 mM MgCl₂ to stabilize the protein during expression

What purification strategies yield the highest purity and stability for recombinant CorA protein?

Purification of recombinant C. jejuni CorA requires careful consideration of buffer conditions to maintain protein stability. A multi-step purification approach is recommended:

Purification protocol:

  • Cell lysis in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM MgCl₂, and protease inhibitors

  • Affinity chromatography using Ni-NTA for His-tagged proteins or glutathione-Sepharose for GST-fusion proteins

  • Tag removal using appropriate proteases (if necessary)

  • Ion-exchange chromatography to separate charged species

  • Size-exclusion chromatography as a final polishing step

  • The presence of 5-10 mM MgCl₂ in all buffers significantly enhances protein stability

Storage conditions: Purified protein should be stored in buffer containing 20 mM HEPES (pH 7.5), 150 mM NaCl, 5 mM MgCl₂, and 5% glycerol at -80°C for long-term storage or at 4°C for short-term use .

How can researchers measure magnesium transport activity of recombinant CorA in vitro?

Several complementary approaches can be used to measure CorA-mediated magnesium transport:

Liposome-based transport assays:

  • Reconstitute purified CorA into liposomes

  • Load liposomes with a Mg²⁺-sensitive fluorescent dye (e.g., Mag-Fura-2)

  • Create a Mg²⁺ gradient across the liposome membrane

  • Monitor fluorescence changes as an indicator of Mg²⁺ transport

Electrophysiological methods:

  • Incorporate CorA into planar lipid bilayers or oocyte expression systems

  • Use patch-clamp techniques to measure Mg²⁺-dependent currents

  • Quantify transport kinetics and ion selectivity

Isotope flux assays:

  • Use radioactive ²⁸Mg²⁺ to track uptake into proteoliposomes

  • Implement a rapid filtration protocol to measure transport over time

  • Calculate transport rates under various conditions (pH, membrane potential, competing ions)

What methods can be used to study the interaction of CorA with different divalent cations?

Recent studies show that cjCorACD interacts with various divalent cations beyond Mg²⁺, including Ca²⁺, Ni²⁺, Zn²⁺, and Mn²⁺. To characterize these interactions:

Thermal shift assays (TSA):

  • Mix purified cjCorACD with SYPRO Orange dye

  • Add different divalent cations at varying concentrations

  • Monitor protein melting temperature shifts using real-time PCR equipment

  • Increased thermostability indicates cation binding

Isothermal titration calorimetry (ITC):

  • Titrate divalent cations into a solution of purified cjCorACD

  • Measure heat changes during binding

  • Calculate binding affinity, stoichiometry, and thermodynamic parameters

Structural studies:

  • Co-crystallize cjCorACD with different divalent cations

  • Solve structures using X-ray crystallography

  • Identify binding sites and coordination geometries for each cation

  • Compare structural changes induced by different cations

What strategies can be employed to generate and verify corA knockout mutants in C. jejuni?

Creating and verifying corA knockout mutants requires careful consideration due to the essential nature of this gene:

Generation of knockout mutants:

  • Design a construct with a kanamycin resistance cassette flanked by sequences homologous to regions upstream and downstream of corA

  • Transform C. jejuni with the construct using electroporation

  • Select transformants on media containing kanamycin and 20 mM MgCl₂ (critical for mutant survival)

  • Verify the double crossover event by PCR analysis

Verification methods:

  • PCR verification with primers outside the recombination region

  • Whole genome sequencing to confirm clean deletion without secondary mutations

  • Phenotypic verification by testing growth on media with and without Mg²⁺ supplementation

  • Complementation studies by reintroducing the corA gene to restore wild-type phenotype

How can site-directed mutagenesis be used to identify key functional residues in C. jejuni CorA?

Site-directed mutagenesis is a powerful approach to identify functional residues in CorA:

Experimental approach:

  • Based on structural data, target conserved negatively charged residues (Asp, Glu) at the bottom of cjCorACD

  • Generate point mutations using PCR-based methods

  • Express and purify mutant proteins

  • Characterize mutants using:

    • Thermal stability assays in the presence of divalent cations

    • In vitro transport assays

    • Structural studies to examine conformational changes

Key residues to target:

  • The conserved GMN motif at the entrance of the channel

  • Negatively charged residues involved in cation coordination

  • Residues at the monomer-monomer interface that might affect oligomerization

  • Residues in the hydrophobic gate region that regulate ion permeation

How does the unique pentamerization-independent cation binding of C. jejuni CorA contribute to its function in magnesium homeostasis?

The recent discovery that cjCorACD binds divalent cations away from the pentamerization interface, unlike other bacterial CorA proteins, raises important questions about its regulatory mechanism:

Research approaches:

  • Combine structural studies with molecular dynamics simulations to model how cation binding at these unique sites affects channel gating

  • Compare the kinetics of Mg²⁺ transport between C. jejuni CorA and other bacterial CorAs

  • Investigate whether this unique property provides adaptive advantages in the specific environmental niches of C. jejuni

Experimental design:

  • Generate chimeric proteins combining domains from different bacterial CorA proteins

  • Assess how these chimeric proteins respond to divalent cations

  • Evaluate transport activity using proteoliposome-based assays

  • Determine whether the unique binding mode affects ion selectivity or transport efficiency

How does CorA contribute to C. jejuni pathogenesis and host colonization?

Understanding CorA's role in C. jejuni pathogenesis requires integrating molecular approaches with infection models:

Research approach:

  • Employ conditional knockout systems to study CorA function in vivo

  • Use RNA-seq to identify genes differentially expressed in CorA-deficient strains during colonization

  • Investigate how magnesium limitation affects C. jejuni virulence factor expression

Animal model studies:

  • Use corA mutants complemented with wild-type or mutant variants in chicken colonization models

  • Employ competition assays between wild-type and corA mutant strains

  • Track bacterial populations in different intestinal compartments

  • Assess the impact of dietary magnesium on colonization efficiency

Host-pathogen interaction:

  • Examine how epithelial cells regulate magnesium availability during infection

  • Investigate whether host immunity targets magnesium acquisition systems

  • Determine if CorA plays a role in intracellular survival of C. jejuni

How does C. jejuni CorA compare with magnesium transport systems in other enteric pathogens?

Comparative analysis provides insights into the evolutionary adaptations of CorA in different bacterial species:

Comparative genomics approach:

  • Perform phylogenetic analysis of CorA sequences across various enteric pathogens

  • Identify conserved and variable regions that may reflect adaptation to specific niches

  • Correlate sequence variations with differences in magnesium requirements

Functional comparison:

OrganismPrimary Mg²⁺ TransporterSecondary SystemsUnique Features
C. jejuniCorANone identifiedPentamerization-independent cation binding
E. coliCorAMgtA, MgtBMultiple redundant systems
SalmonellaCorAMgtA, MgtB, MgtCMgtC involved in virulence
H. pyloriCorAMgtEAdapted to acidic environment

Experimental validation:

  • Express CorA homologs from different pathogens in a common host

  • Compare their functional properties under standardized conditions

  • Assess whether differences correlate with pathogen lifestyle or host range

What is the relationship between magnesium transport through CorA and other essential cellular processes in C. jejuni?

Magnesium is essential for numerous cellular processes, and CorA-mediated transport likely affects multiple aspects of C. jejuni physiology:

Systems biology approach:

  • Perform transcriptomic and proteomic analyses of C. jejuni under varying magnesium concentrations

  • Identify pathways coregulated with corA expression

  • Map the magnesium-dependent "interactome" using protein-protein interaction studies

Metabolic impact:

  • Use metabolomics to profile changes in C. jejuni under magnesium limitation

  • Focus on ATP-dependent processes, protein synthesis, and cell wall biosynthesis

  • Quantify the impact on motility, biofilm formation, and stress responses

Regulatory networks:

  • Identify transcription factors that regulate corA expression

  • Characterize how magnesium status is sensed and integrated with other stress responses

  • Investigate cross-talk between magnesium homeostasis and other metal ion regulatory systems

What is the potential of C. jejuni CorA as a vaccine candidate?

CorA's essential nature and conservation across C. jejuni strains make it an interesting vaccine target:

Vaccine development considerations:

  • CorA is highly conserved across C. jejuni strains, suggesting potential for broad protection

  • As an essential protein, immune targeting could effectively inhibit bacterial growth

  • Limited sequence similarity with human proteins reduces autoimmunity concerns

Experimental approach:

  • Identify immunogenic epitopes in the extracellular loops of CorA

  • Express and purify recombinant fragments containing these epitopes

  • Formulate with appropriate adjuvants

  • Test immunogenicity and protective efficacy in animal models

  • Evaluate cross-protection against different C. jejuni serotypes

Challenges to address:

  • Limited surface exposure may reduce antibody accessibility

  • Potential for antigenic variation in surface-exposed regions

  • Need for appropriate animal models that recapitulate human disease

How might CorA be exploited as a target for antimicrobial development against C. jejuni?

The essential role of CorA in C. jejuni viability makes it a potential target for novel antimicrobials:

Drug development strategies:

  • Structure-based design of small molecules that block the CorA channel

  • High-throughput screening for compounds that inhibit Mg²⁺ transport

  • Repurposing of known channel blockers that might interact with CorA

Target validation approach:

  • Develop assays to measure CorA inhibition in vitro

  • Test candidate compounds for growth inhibition of C. jejuni

  • Confirm target specificity using resistant mutants and biochemical assays

  • Evaluate efficacy in infection models

Considerations for antimicrobial development:

  • Selectivity for bacterial versus host Mg²⁺ transporters

  • Potential development of resistance mechanisms

  • Pharmacokinetic properties necessary for intestinal delivery

  • Combination approaches targeting multiple essential processes

What are the main challenges in working with recombinant C. jejuni CorA and how can they be overcome?

Working with membrane proteins like CorA presents several technical challenges:

Expression challenges and solutions:

  • Poor expression - Optimize codon usage for the expression host and use strong inducible promoters

  • Protein toxicity - Use tight expression control systems and lower induction temperatures

  • Inclusion body formation - Express protein at lower temperatures (16-18°C) and use solubility tags

Purification challenges and solutions:

  • Detergent selection - Screen multiple detergents for optimal extraction and stability

  • Protein aggregation - Include stabilizing agents (glycerol, specific ions) in all buffers

  • Maintaining native conformation - Use mild detergents or nanodiscs for functional studies

Functional characterization challenges:

  • Establishing proper orientation in reconstituted systems

  • Distinguishing specific transport from leakage

  • Accounting for effects of the artificial membrane environment

Practical workflow:

  • Start with the soluble cytoplasmic domain for initial studies

  • Progress to full-length protein expression using specialized membrane protein expression systems

  • Consider cell-free expression systems for difficult constructs

How can researchers address the genetic manipulation challenges in C. jejuni?

C. jejuni is known to be difficult to manipulate genetically compared to model organisms:

Transformation optimization:

  • Use highly competent C. jejuni strains (e.g., 81-176, NCTC 11168)

  • Harvest cells in early to mid-log phase

  • Optimize electroporation parameters (voltage, resistance, capacitance)

  • Use methylation-proficient E. coli strains to prepare DNA that can escape C. jejuni restriction systems

Gene knockout strategies for essential genes:

  • Use conditional expression systems with inducible promoters

  • Implement CRISPR-Cas9 systems adapted for C. jejuni

  • Employ partial deletions that maintain essential functions

  • Consider merodiploid approaches

Complementation strategies:

  • Use chromosomal integration at neutral loci

  • Control expression with native or inducible promoters

  • Include appropriate transcriptional terminators

  • Verify protein expression levels match wild-type conditions

Verification methods:

  • Combine PCR, RT-qPCR, Western blotting, and phenotypic assays

  • Use whole-genome sequencing to verify clean genetic modifications

  • Perform complementation studies to confirm phenotype specificity

What emerging technologies could advance our understanding of CorA function in C. jejuni?

Several cutting-edge technologies hold promise for deeper insights into CorA function:

Cryo-electron microscopy:

  • Determine high-resolution structures of full-length CorA in different conformational states

  • Visualize the channel in native-like lipid environments

  • Capture transient intermediates during ion transport

Single-molecule techniques:

  • Apply FRET to monitor conformational changes during channel gating

  • Use single-channel recordings to characterize transport properties

  • Implement single-molecule tracking in live bacteria to study CorA dynamics

Advanced genetic approaches:

  • Apply CRISPR interference for tunable gene expression

  • Develop high-throughput mutagenesis coupled with deep sequencing

  • Use optogenetic tools to control CorA activity with spatial and temporal precision

Integrative structural biology:

  • Combine X-ray crystallography, cryo-EM, and molecular dynamics simulations

  • Map conformational landscapes using hydrogen-deuterium exchange mass spectrometry

  • Employ cross-linking mass spectrometry to identify interacting partners

How might environmental factors influence CorA function and magnesium homeostasis in C. jejuni?

C. jejuni encounters diverse environments during its lifecycle, from poultry intestines to human hosts:

Research questions to address:

  • How do temperature shifts (37°C to 42°C) affect CorA expression and function?

  • Does oxygen tension influence magnesium requirements and transport?

  • How do host-derived antimicrobial peptides affect CorA-mediated transport?

Experimental approaches:

  • Use transcriptomics and proteomics to profile C. jejuni response to environmental stressors

  • Develop biosensors to measure intracellular magnesium concentrations under various conditions

  • Investigate CorA regulation during biofilm formation versus planktonic growth

  • Examine host factors that might modulate magnesium availability during infection

Integration with pathogenesis models:

  • Study CorA function during different stages of infection

  • Investigate interplay between magnesium availability and expression of virulence factors

  • Determine if CorA contributes to antimicrobial resistance phenotypes

How can bioinformatic approaches help identify structural and functional features of CorA across Campylobacter species?

Computational approaches offer powerful tools for comparative analysis:

Bioinformatic methods:

  • Multiple sequence alignment of CorA proteins across Campylobacter species

  • Identification of conserved motifs and variable regions

  • Prediction of transmembrane domains and surface-exposed loops

  • Homology modeling based on available crystal structures

Structural bioinformatics:

  • Molecular dynamics simulations to study ion permeation

  • Prediction of conformational changes upon ion binding

  • Identification of potential drug-binding pockets

  • Analysis of coevolving residues to infer functional coupling

Genomic context analysis:

  • Examine conservation of gene neighborhood around corA

  • Identify potential regulatory elements in the corA promoter region

  • Look for evidence of horizontal gene transfer events

  • Compare genomic organization across pathogenic and non-pathogenic species

What insights can be gained from integrating transcriptomic and proteomic data with structural information of CorA?

Multi-omics integration provides a systems-level understanding of CorA function:

Data integration approach:

  • Correlate corA expression levels with global transcriptional changes

  • Map protein-protein interactions involving CorA

  • Identify co-regulated genes that may function in the same pathways

  • Connect structural features to expression patterns under different conditions

Analytical workflow:

  • Generate transcriptomic data under varying magnesium concentrations

  • Perform proteomic analysis focusing on membrane proteins

  • Use machine learning to identify patterns in the multi-omics data

  • Validate predictions with targeted experiments

Expected insights:

  • Regulatory networks controlling magnesium homeostasis

  • Potential moonlighting functions of CorA beyond ion transport

  • Adaptation mechanisms to magnesium limitation

  • Connections between magnesium homeostasis and virulence regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.