Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme responsible for catalyzing the first step in bacterial lipoprotein biosynthesis. It transfers a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of a conserved cysteine residue in prolipoproteins, anchoring them to the membrane . In C. jejuni, this enzyme is encoded by the lgt gene (UniProt ID: A1VYC7/Q9PI98) and plays a pivotal role in maintaining outer membrane integrity and virulence .

Expression and Purification

Recombinant Lgt is produced in E. coli systems, enabling high-yield synthesis for structural and functional studies. Key steps include:

  1. Cloning: The lgt gene is inserted into expression vectors under inducible promoters.

  2. Purification: Affinity chromatography (His-tag) followed by lyophilization for long-term storage .

Research Applications

  • Pathogenesis Studies: Lgt is critical for lipooligosaccharide (LOS) biosynthesis in C. jejuni, which mimics human gangliosides to evade immune detection .

  • Antibiotic Development: Inhibitors targeting Lgt disrupt bacterial membrane integrity, increasing sensitivity to antibiotics and serum killing .

  • Vaccine Development: Recombinant Lgt serves as an antigen for antibody production and immunological assays .

Functional Characterization

  • LOS Biosynthesis: Mutations in lgt result in truncated LOS cores lacking glucose residues, impairing bacterial survival in hostile environments .

  • Membrane Permeability: Depletion of Lgt in E. coli increases outer membrane permeability, enhancing susceptibility to β-lactams and macrolides .

Therapeutic Potential

  • Inhibitor Screening: Novel Lgt inhibitors (e.g., small-molecule compounds) show bactericidal activity against multidrug-resistant Acinetobacter baumannii and E. coli .

  • Antimicrobial Synergy: Combining Lgt inhibitors with traditional antibiotics reduces minimum inhibitory concentrations (MICs) by >10-fold .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Cj0407; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
lgt
Target Protein Sequence
MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVRKFQLDINEKHLDSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGVLRH PSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: cje:Cj0407

STRING: 192222.Cj0407

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) in Campylobacter jejuni?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in Campylobacter jejuni responsible for the first step in bacterial lipoprotein biosynthesis. It catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox motif of prolipoproteins. This post-translational modification is crucial for proper lipoprotein anchoring to bacterial membranes. In Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168), the lgt protein consists of 271 amino acids and plays a vital role in bacterial cell envelope integrity and pathogenesis . The protein is part of a lipid modification pathway that impacts bacterial virulence and interaction with host immune systems, making it a significant target for both basic research and therapeutic development.

How does lgt contribute to Campylobacter jejuni pathogenesis?

Lgt contributes to C. jejuni pathogenesis through multiple mechanisms related to bacterial membrane structure and function. By facilitating proper lipoprotein anchoring to the membrane, lgt ensures correct localization of virulence-associated lipoproteins that interact with host cells. These lipoproteins can trigger inflammatory responses and contribute to the gastroenteritis symptoms characteristic of C. jejuni infection . Additionally, properly processed lipoproteins play roles in nutrient acquisition, stress responses, and adherence to intestinal epithelial cells, all of which enhance bacterial survival in the host. Research methodologies to study lgt's role in pathogenesis typically involve generating lgt mutants and comparing their virulence properties with wild-type strains in both in vitro cell cultures and animal models, revealing changes in colonization ability, inflammatory responses, and disease progression.

What is known about the relationship between lgt and lipooligosaccharide (LOS) biosynthesis?

While lgt itself is not directly part of the LOS biosynthesis pathway, both lipoprotein processing and LOS biosynthesis contribute to outer membrane integrity and pathogen-host interactions. C. jejuni exhibits significant variation in the genetic content of LOS biosynthesis loci, which are grouped into at least six classes based on gene content and organization . The LOS structures impact bacterial surface characteristics and can mimic human gangliosides, potentially contributing to post-infection sequelae like Guillain-Barré syndrome . Methodologically, researchers investigating potential interactions between lipoprotein processing and LOS biosynthesis employ techniques such as gene knockout studies, complementation experiments, and transcriptomic analyses to identify regulatory networks that may coordinate these distinct but functionally related pathways.

What expression systems are optimal for producing recombinant Campylobacter jejuni lgt?

Multiple expression systems have been successfully utilized for producing recombinant C. jejuni lgt, each with distinct advantages depending on research objectives. The search results indicate that recombinant lgt protein can be produced in several systems including E. coli, yeast, baculovirus, and mammalian cell expression platforms . For most basic research applications, E. coli expression systems offer high yield and cost-effectiveness, typically employing BL21(DE3) or other protease-deficient strains with pET vectors containing the lgt gene optimized for E. coli codon usage. For structural studies requiring proper folding, yeast systems (particularly Pichia pastoris) may provide better results due to their eukaryotic protein processing capabilities. When studying post-translational modifications or for vaccine development applications, mammalian cell lines or baculovirus systems offer advantages despite their higher cost and complexity . The methodological approach should include optimization of induction conditions (temperature, inducer concentration, duration) and careful monitoring of protein solubility through small-scale expression trials before scaling up.

What purification methods yield the highest purity of recombinant lgt?

Purification of recombinant C. jejuni lgt requires specialized protocols due to its hydrophobic nature as a membrane-associated enzyme. A multi-step purification strategy typically begins with cell lysis under conditions that solubilize membrane proteins, using detergents such as n-dodecyl β-D-maltoside (DDM) or 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS). When the recombinant protein contains an affinity tag (His, GST, or MBP), the initial capture step employs affinity chromatography, followed by ion exchange chromatography to remove contaminants with different charge properties . Size exclusion chromatography serves as a polishing step to achieve >95% purity as assessed by SDS-PAGE and Western blotting. For structural biology applications, detergent exchange during purification may be necessary to maintain protein stability while providing a suitable environment for downstream analyses. Researchers should establish quality control checkpoints throughout the purification process, including activity assays to ensure the purified enzyme retains its catalytic function.

How can researchers validate the structural integrity of recombinant lgt?

Validation of recombinant lgt structural integrity requires multiple complementary approaches. Circular dichroism (CD) spectroscopy can assess secondary structure content, comparing results to predictions based on the amino acid sequence. Thermal shift assays provide information about protein stability and can be used to optimize buffer conditions. For tertiary structure analysis, limited proteolysis followed by mass spectrometry can identify accessible regions and confirm proper folding. Functional assays measuring the enzymatic activity of recombinant lgt provide the most relevant validation, typically using synthetic peptide substrates containing the lipobox motif and monitoring diacylglyceryl transfer. Native PAGE and analytical ultracentrifugation can detect aggregation states, while dynamic light scattering assesses sample homogeneity. For researchers studying C. jejuni lgt specifically, comparing the properties of recombinant proteins from different expression systems helps identify the best approach for maintaining native-like structure and function.

What role does lgt play in Campylobacter jejuni's antimicrobial resistance mechanisms?

The relationship between lgt and antimicrobial resistance in C. jejuni represents an emerging research area of significant clinical relevance. An increasing proportion of human infections caused by C. jejuni are resistant to antimicrobial therapy . Lgt's function in properly anchoring membrane lipoproteins may indirectly influence antimicrobial resistance by affecting membrane permeability and drug efflux pump placement. Research methodologies to investigate this relationship include generating lgt knockout or modified expression mutants and examining changes in minimum inhibitory concentrations (MICs) for various antibiotics. RNA-seq analyses comparing wild-type and lgt-modified strains under antibiotic stress can reveal differential gene expression patterns in resistance-associated pathways. Researchers should employ time-kill assays and resistance development studies comparing parent and lgt-modified strains exposed to sub-inhibitory antibiotic concentrations over multiple generations to identify any role in resistance acquisition or maintenance.

How can recombinant lgt be utilized in vaccine development against Campylobacter jejuni?

Recombinant lgt has significant potential for C. jejuni vaccine development through multiple approaches. As noted in the search results, commercial recombinant lgt proteins are specifically advertised as useful for vaccine development . As an antigen, recombinant lgt could elicit antibodies that neutralize bacterial lipoprotein processing, thus compromising bacterial membrane integrity. Methodologically, researchers can evaluate recombinant lgt as a vaccine candidate by immunizing animal models and assessing protection against challenge with virulent C. jejuni strains. Immunological assays including ELISA, ELISpot, and flow cytometry can characterize the humoral and cellular immune responses generated. Alternatively, lgt can be employed as a carrier protein or adjuvant fused to other C. jejuni antigens to enhance their immunogenicity. Researchers developing such approaches should investigate both systemic (injectable) and mucosal (oral, intranasal) delivery routes, as C. jejuni is an enteric pathogen where mucosal immunity plays a crucial role in protection.

What analytical techniques are most effective for characterizing lgt enzyme kinetics?

Characterizing lgt enzyme kinetics requires specialized analytical techniques due to the membrane-associated nature of both the enzyme and its substrates. Researchers typically employ synthetic fluorescent substrates containing the lipobox motif, which show increased fluorescence upon diacylglyceryl transfer. Real-time monitoring of this fluorescence change enables determination of kinetic parameters (Km, kcat, Vmax) under varying substrate concentrations, pH conditions, and temperature ranges. Mass spectrometry provides definitive evidence of substrate modification by detecting mass shifts corresponding to diacylglyceryl addition. For more detailed mechanism studies, radiolabeled phospholipid donors can trace the transfer process. Computational approaches such as molecular dynamics simulations complement experimental data by modeling enzyme-substrate interactions at the atomic level. When analyzing kinetic data, researchers should consider the detergent micelle environment's impact on substrate presentation and employ appropriate mathematical models that account for two-dimensional diffusion effects in membrane-associated enzymes.

What are the optimal storage conditions for recombinant lgt to maintain activity?

Optimal storage conditions for recombinant C. jejuni lgt are critical for maintaining enzymatic activity during experimental timeframes. According to the search results, commercial preparations typically recommend storage at -20°C for regular usage, with -80°C recommended for extended storage periods . The protein is often supplied in a Tris-based buffer containing 50% glycerol as a cryoprotectant to prevent freeze-thaw damage . For working solutions, storage at 4°C is suitable for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and activity loss . Researchers should aliquot the purified protein into single-use volumes immediately after purification to minimize freeze-thaw events. For activity-critical applications, researchers should perform time-course stability studies under various storage conditions, regularly testing enzyme activity to establish reliable storage protocols specific to their recombinant lgt preparation. Addition of reducing agents such as dithiothreitol (1-5 mM) can help maintain cysteine residues in their reduced state, preserving activity.

How do researchers overcome challenges in expressing Campylobacter jejuni lgt in heterologous systems?

Expressing C. jejuni lgt in heterologous systems presents several challenges due to its membrane association and potential toxicity when overexpressed. To overcome codon usage bias when expressing in E. coli, researchers should either optimize the gene sequence for E. coli codon preference or use specialized strains with rare tRNA supplements. Fusion tags can improve solubility, with maltose-binding protein (MBP) or SUMO tags often providing better results than simple His-tags. Controlling expression level through tunable promoters (like rhamnose-inducible systems) rather than strong constitutive or IPTG-inducible promoters prevents toxic accumulation. Lower induction temperatures (16-20°C) slow protein production, allowing proper folding and membrane insertion. For mammalian or insect cell expression, researchers can incorporate signal sequences directing the protein to appropriate cellular compartments. Co-expression with chaperones specific for membrane proteins, such as Hsp70 family members, can significantly improve folding efficiency and yield.

What controls are essential when studying recombinant lgt in functional assays?

When designing functional assays for recombinant lgt, multiple controls are essential to ensure valid interpretation of results. Negative controls should include heat-inactivated enzyme preparations to distinguish enzymatic activity from non-specific reactions. Substrate specificity controls using peptides with mutated lipobox motifs confirm the enzyme recognizes authentic substrates. When studying inhibitors, researchers should include controls to detect compound interference with detection methods rather than true enzyme inhibition. Competition assays with known lgt substrates validate the specificity of novel substrate candidates. For experiments examining lgt's role in pathogenesis, complementation controls (where the wild-type gene is reintroduced into knockout strains) confirm phenotypic changes are specifically due to lgt function rather than polar effects on adjacent genes. Time-course experiments should include sampling at multiple timepoints to establish reaction linearity and appropriate enzyme concentrations. Researchers should additionally test recombinant lgt from different expression systems to confirm that observed properties are intrinsic to the enzyme rather than artifacts of a particular production method .

How do researchers interpret contradictory data regarding lgt function across different Campylobacter strains?

Interpreting contradictory findings regarding lgt function across Campylobacter strains requires systematic analysis of potential sources of variation. C. jejuni exhibits significant genetic diversity, particularly in regions affecting surface structures, which may extend to differences in lgt function or regulation . When faced with contradictory data, researchers should first examine the specific strains used, comparing their genetic backgrounds through whole genome sequence analysis to identify polymorphisms in lgt and related genes. The search results highlight that even within C. jejuni, significant genetic variation exists between strains, particularly in surface structure biosynthesis loci . Methodologically, researchers should conduct parallel experiments using identical protocols across multiple strains to distinguish strain-specific from general lgt properties. Meta-analysis approaches combining results from multiple studies can identify patterns in strain-specific behaviors. For mechanistic understanding, complementation experiments swapping lgt genes between strains can determine whether contradictions arise from the lgt gene itself or from differences in genetic background. Researchers should consider establishing standardized assay conditions and reference strains to facilitate cross-laboratory comparisons and resolve apparent contradictions.

What bioinformatic approaches can enhance understanding of lgt structure-function relationships?

Advanced bioinformatic approaches offer powerful tools for understanding lgt structure-function relationships despite limited experimental structural data. Sequence conservation analysis across multiple bacterial species can identify functionally critical residues that remain invariant despite evolutionary divergence. Homology modeling using structurally characterized lgt enzymes from other bacteria provides initial structural insights, especially when refined against experimental biochemical data. Molecular dynamics simulations can predict how substrate binding affects protein conformation and how mutations might alter function. Machine learning approaches trained on known enzyme-substrate interactions can predict novel substrates or inhibitors. Researchers should employ transmembrane topology prediction algorithms to accurately map membrane-spanning regions, combined with hydrophobicity analysis to identify potential substrate interaction sites. Coevolution analysis can reveal networks of functionally coupled residues that may not be proximal in sequence but interact in the folded structure. For C. jejuni specifically, comparative genomics across strains with phenotypic differences in lipoprotein processing can highlight natural variants that inform structure-function relationships.

How can researchers correlate lgt function with Campylobacter jejuni virulence in different infection models?

Correlating lgt function with C. jejuni virulence requires systematic comparison across multiple infection models, each capturing different aspects of pathogenesis. In vitro models using intestinal epithelial cell lines can assess bacterial adhesion, invasion, and cytokine responses when comparing wild-type and lgt-modified strains. Ex vivo organ culture systems using human or animal intestinal tissue provide a more complex model incorporating multiple cell types in their native architecture. For in vivo studies, researchers can use established animal models including chickens (natural reservoir), mice, and ferrets, each offering different advantages for studying colonization, disease progression, or immune responses . Molecular approaches such as RNA-seq of host tissues and bacterial cells during infection can reveal how lgt affects both bacterial gene expression and host responses. Correlation analyses should examine multiple virulence parameters including colonization efficiency, tissue damage, inflammatory markers, and bacterial persistence. Researchers should employ systematic statistical approaches such as principal component analysis to integrate diverse datasets and identify patterns linking specific aspects of lgt function to particular virulence phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.