Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative protein-disulfide oxidoreductase (Cj0865)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
dsbI; Cj0865; Putative protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
dsbI
Target Protein Sequence
MSCIKMKDKCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMKPCEQCVYIRF DMLVMAIGGMIALINPANNIIKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVD GCREIPIYPFNLPLYKWASSWFLPTGECGMDTPVVPENAYNHLNAFQKFFIGTPPDFENG LYSNGWYLIPSLKFMNMAICCLIAFLCCFVVLFAMFIAYVLDKNKPNAKIFALVIVALVL VLKFIGESKNPNQNIASLNQVVLRYS
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain proteins. It is part of a redox system (DsbI and DsbL) that facilitates the formation of a crucial disulfide bond within AssT.
Database Links

KEGG: cje:Cj0865

STRING: 192222.Cj0865

Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between Cj0865 and other Dsb proteins in the C. jejuni genome?

Cj0865 is part of the disulfide bond formation system in C. jejuni, which includes several other Dsb proteins organized in specific genomic clusters. Based on genomic analysis, C. jejuni contains two major dsb gene clusters: the dsbA2-dsbB-astA-dsbA1 cluster and the dba-dsbI cluster . These genes are arranged in specific orientations with short intergenic regions that facilitate co-transcription in some cases. For example, dsbA2-dsbB-astA-dsbA1 genes (cjj81176_0880-0883) have the same orientation and are separated by intergenic regions of 11 bp, 87 bp, and 85 bp respectively .

The expression pattern of these dsb genes is regulated by specific promoter sequences. In silico analysis has identified:

  • A complete promoter sequence upstream of dsbA2 (including -35, -16, and -10 regions characteristic for σ70 binding)

  • Potential ribosome binding sites (RBS) upstream of dsbB, but no complete promoter sequence, suggesting dsbA2-dsbB co-transcription

  • Putative RBS sequences and incomplete promoter sequences upstream of astA and dsbA1, suggesting they might be transcribed separately

Understanding Cj0865's relationship with these other Dsb proteins requires experimental investigation of its genomic context, promoter structures, and transcriptional patterns similar to those conducted for other dsb genes.

How does the CXXC active site motif contribute to Cj0865's oxidoreductase function?

The CXXC motif is the catalytic core of protein disulfide oxidoreductases, including Cj0865. This conserved sequence contains two cysteine residues separated by two variable amino acids that catalyze dithiol-disulfide exchange reactions . The specific chemical properties and spatial arrangement of these residues are critical for proper function.

Research on related protein disulfide oxidoreductases provides insight into how these motifs function:

  • Mechanistic role: The CXXC motif cycles between oxidized (disulfide) and reduced (dithiol) states to catalyze:

    • Oxidation: Transfer of disulfide bonds to substrate proteins

    • Reduction: Breaking of disulfide bonds in substrate proteins

    • Isomerization: Rearrangement of incorrectly formed disulfide bonds

  • Site-specific contributions: Studies of the protein disulfide oxidoreductase from Pyrococcus furiosus (PfPDO) demonstrated that different CXXC sites serve distinct functions. Mutation studies (C35S and C146S) revealed that:

    • The CPYC site in the C-terminal half is essential for reductive/oxidative activity

    • Both active sites are required for isomerase activity

For experimental characterization of Cj0865's CXXC sites, researchers should consider:

  • Site-directed mutagenesis changing cysteine residues to serine (as in the PfPDO study)

  • Functional assays measuring oxidative, reductive, and isomerase activities with each mutant

  • Structural studies to determine the spatial arrangement of the CXXC motifs

What are the most effective methods for generating a Cj0865 knockout mutant?

Based on established protocols for C. jejuni mutagenesis, several strategies can be employed to create Cj0865 knockout mutants:

Method 1: Insertional inactivation by antibiotic cassette replacement

  • PCR-amplify a ~1.5 kb DNA fragment containing the Cj0865 gene from C. jejuni genomic DNA

  • Clone this fragment into a vector such as pGEM-T Easy

  • Replace an internal region of Cj0865 with an antibiotic resistance cassette (e.g., chloramphenicol resistance gene)

  • Ensure the cassette is inserted in the same transcriptional orientation as Cj0865

  • Transform the resulting suicide plasmid into C. jejuni for homologous recombination

Method 2: Complete gene deletion by double crossover

  • Amplify two DNA fragments containing the upstream and downstream regions of Cj0865

  • Digest fragments with appropriate restriction enzymes

  • Ligate fragments in native orientation

  • Clone into an appropriate vector

  • Insert an antibiotic resistance cassette between the upstream and downstream fragments

  • Transform into C. jejuni for homologous recombination

Method 3: Inverse PCR mutagenesis

  • Design primers that anneal to sequences flanking the region to be deleted

  • Perform PCR using these primers to amplify the entire plasmid except the target region

  • Insert an antibiotic resistance marker at the junction

  • Transform the construct for homologous recombination

To verify successful mutation, perform:

  • PCR confirmation with primers flanking the insertion site

  • RT-PCR to confirm absence of Cj0865 transcription

  • Western blot if antibodies against Cj0865 are available

What assays can be used to characterize the enzymatic activity of purified recombinant Cj0865?

To comprehensively characterize Cj0865's enzymatic functions, researchers should employ multiple complementary assays:

Oxidative activity assay

  • Purpose: Measure Cj0865's ability to catalyze disulfide bond formation

  • Method: Monitor the oxidation of reduced model substrates (e.g., reduced RNase A)

  • Detection: Measure either substrate reactivation or formation of disulfide bonds

Reductive activity assay

  • Purpose: Assess Cj0865's ability to reduce disulfide bonds

  • Method: Incubate with disulfide-containing substrates

  • Detection: Measure the generation of free thiols using reagents like DTNB (Ellman's reagent)

Isomerase activity assay

  • Purpose: Evaluate ability to rearrange incorrect disulfide bonds

  • Method: Use scrambled RNase A (with incorrect disulfide pairings) as substrate

  • Detection: Measure restoration of RNase A enzymatic activity

ATPase activity test

  • Purpose: Determine if Cj0865 has ATPase activity (like PfPDO)

  • Method: Incubate with ATP under various conditions

  • Parameters to test: Cation dependence, pH optima, temperature optima

Experimental workflow:

  • Express recombinant Cj0865 with a 6XHis-tag in an appropriate expression system

  • Purify using nickel affinity chromatography

  • Verify purity by SDS-PAGE and Coomassie staining

  • Quantify protein concentration

  • Perform activity assays under standardized conditions

  • Analyze enzyme kinetics (Km, Vmax, kcat)

For functional characterization of specific domains, create site-directed mutants altering key residues in the CXXC motifs (similar to C35S and C146S mutations in PfPDO) .

How is Cj0865 expression regulated in response to environmental stressors like iron limitation?

Iron regulation is a significant factor in dsb gene expression in C. jejuni. Research has identified "a new iron- and Fur-regulated promoter that drives dsbA1 gene expression in an indirect way" . A similar regulatory mechanism may exist for Cj0865.

Experimental approach to investigate iron regulation:

  • Growth conditions: Culture C. jejuni under:

    • Iron-replete conditions

    • Iron-limited conditions using chelators like deferoxamine

    • Iron-limited conditions with exogenous iron supplementation

  • Expression analysis methods:

    • RT-PCR to analyze Cj0865 transcript levels under different conditions

    • qRT-PCR for quantitative analysis

    • Microarray analysis to examine global expression changes

    • Western blot to assess protein levels using antibodies against Cj0865 or epitope-tagged versions

  • Promoter analysis:

    • In silico examination of sequences upstream of Cj0865 for potential Fur binding sites

    • Reporter gene fusions to map promoter elements

    • Electrophoretic mobility shift assays (EMSA) to detect Fur binding

    • Chromatin immunoprecipitation (ChIP) to identify Fur binding in vivo

  • Genetic approaches:

    • Compare Cj0865 expression in wild-type vs. fur mutant backgrounds

    • Mutational analysis of putative Fur binding sites

The data can be analyzed to determine:

  • Direct vs. indirect regulation by Fur

  • Magnitude of response to iron limitation

  • Temporal dynamics of expression changes

  • Co-regulation with other dsb genes

What role does Cj0865 play in C. jejuni stress resistance and pathogenesis?

To investigate Cj0865's role in stress resistance and pathogenesis, researchers should compare wild-type and Cj0865 mutant strains using the following approaches:

Stress resistance assays

  • Oxidative stress: Hydrogen peroxide exposure assays

  • Nitrosative stress: Acidified nitrite assays

  • Bile resistance: Sodium deoxycholate growth inhibition assays

  • Iron limitation response: Growth in the presence of iron chelators

Growth kinetics analysis

  • Primary culture growth kinetics in standard media

  • Secondary culture growth kinetics under various stress conditions

Motility assessment

  • Motility assays in soft agar

  • Microscopic examination of bacterial movement

Pathogenesis-related assays

  • Cellular interaction studies:

    • Adhesion to epithelial cells

    • Invasion of epithelial cells

    • Intracellular survival assays

  • Macrophage survival assays

  • Co-culture studies with host cells

Gene expression analysis

  • Microarray analysis comparing wild-type and Cj0865 mutant under various conditions

  • RT-PCR validation of differentially expressed genes

Data interpretation:
Compare phenotypic differences between wild-type and mutant strains to determine if Cj0865 contributes to:

  • Resistance to specific stressors encountered during infection

  • Ability to adhere to and invade host cells

  • Survival within host cells

  • Global gene expression patterns under stress conditions

Complementation of the Cj0865 mutant should be performed to confirm that phenotypic changes are specifically due to the absence of Cj0865 rather than polar effects or secondary mutations.

How does Cj0865 compare structurally and functionally to protein disulfide oxidoreductases from other organisms?

A comprehensive comparative analysis of Cj0865 with related proteins provides valuable evolutionary and functional insights.

Table 1: Comparison of Protein Disulfide Oxidoreductases from Different Organisms

FeatureCj0865 (C. jejuni)PfPDO (P. furiosus)DsbA (E. coli)PDI (Eukaryotic)
Redox sitesCXXC motifs (predicted)Two CXXC motifsSingle CXXC motifMultiple CXXC motifs
Oxidative activityTo be determinedPresentPresentPresent
Reductive activityTo be determinedPresentLimitedPresent
Isomerase activityTo be determinedRequires both active sitesLimitedPresent
ATPase activityTo be determinedPresent, cation-dependentAbsentAbsent
pH optimumTo be determinedBasicNeutralNeutral to acidic
Temperature optimumTo be determined90°C37°C37°C
Cellular locationPeriplasm (predicted)CytoplasmPeriplasmER lumen

Experimental approaches for comparative analysis:

  • Sequence alignment:

    • Multiple sequence alignment of Cj0865 with homologs

    • Identification of conserved domains and motifs

    • Phylogenetic analysis to establish evolutionary relationships

  • Structural comparison:

    • Homology modeling of Cj0865 based on PfPDO's 3D structure

    • Analysis of active site geometry and substrate binding pockets

    • Prediction of conformational changes during catalytic cycle

  • Functional comparison:

    • Side-by-side activity assays under standardized conditions

    • Substrate specificity profiling

    • Analysis of redox potential differences

    • Cross-complementation studies in respective bacterial species

This comparative approach would reveal whether Cj0865 shares the dual oxidoreductase and isomerase functions observed in PfPDO, and whether it might represent an evolutionary link between bacterial and eukaryotic disulfide bond formation systems .

How does the genomic context of Cj0865 compare to other dsb genes in C. jejuni?

Analyzing the genomic organization of dsb genes provides insights into their potential co-regulation and functional relationships. Based on the analysis of other dsb genes, we can formulate a comparative investigation:

Table 2: Comparative Genomic Context of dsb Genes in C. jejuni

FeaturedsbA2-dsbB-astA-dsbA1 clusterdba-dsbI clusterCj0865 region (to be determined)
Gene orientationSame orientationSame orientationTo be determined
Intergenic regions11 bp, 87 bp, 85 bp11 bpTo be determined
Promoter structuresComplete promoter upstream of dsbA2Promoter within 493 bp upstream of dbaTo be determined
Co-transcriptiondsbA2-dsbB likely co-transcribeddba-dsbI co-transcribedTo be determined
RegulationIron and Fur regulated (dsbA1)To be determinedTo be determined

Methodological approach:

  • Genomic sequence analysis:

    • Identify genes flanking Cj0865

    • Determine orientation and intergenic distances

    • Search for potential promoter sequences and RBS

  • Transcriptional analysis:

    • RT-PCR spanning Cj0865 and adjacent genes to detect co-transcription

    • 5' RACE to identify transcription start sites

    • Promoter-reporter fusions to characterize promoter activity

  • Regulatory studies:

    • Comparison of expression under various conditions (iron availability, oxidative stress)

    • Identification of shared regulatory mechanisms with other dsb genes

How might re-annotation of the C. jejuni genome impact our understanding of Cj0865 function?

Genome re-annotation can significantly alter our understanding of gene function through improved bioinformatic analysis and incorporation of new experimental data. A re-annotation approach similar to that described for C. jejuni NCTC11168 would involve:

  • Updated sequence analysis:

    • BLAST searches against current databases

    • Improved protein family and domain identification

    • Refined prediction of signal peptides and transmembrane regions

    • More accurate prediction of start/stop codons

  • Literature and additional searches:

    • Incorporation of new experimental data on Cj0865 and homologs

    • Integration of recent structural and functional characterizations

    • Updated gene ontology assignments

  • Product designation refinement:

    • Possible reclassification from "putative" to a more specific functional description

    • Updated nomenclature based on newly established protein families

  • Implications for experimental design:

    • Identification of previously unrecognized functional domains for targeted mutagenesis

    • Refinement of protein boundaries for recombinant expression

    • Discovery of potential interaction partners based on genomic context

The re-annotation process represents an ongoing cycle where experimental data informs bioinformatic analysis, which in turn guides further experimentation. For Cj0865, this might reveal unexpected functions beyond the classical disulfide oxidoreductase activity or identify regulatory mechanisms shared with other stress response systems.

What methodological approaches would be most effective for studying protein-protein interactions involving Cj0865?

Understanding Cj0865's interactions with other proteins is crucial for elucidating its role in C. jejuni physiology and pathogenesis.

Recommended methodological approaches:

  • Bacterial two-hybrid system:

    • Fusion of Cj0865 to one domain of a split reporter protein

    • Creation of a C. jejuni genomic library fused to the complementary domain

    • Screening for protein-protein interactions through reporter activation

    • Advantages: Can be performed in a bacterial system; high-throughput capability

  • Co-immunoprecipitation:

    • Expression of epitope-tagged Cj0865 in C. jejuni

    • Immunoprecipitation under native conditions

    • Mass spectrometry identification of co-precipitated proteins

    • Advantages: Detects interactions in native cellular environment; identifies complexes

  • Pull-down assays:

    • Purification of recombinant 6XHis-tagged Cj0865

    • Incubation with C. jejuni cell lysates

    • Identification of bound proteins by mass spectrometry

    • Advantages: High specificity; controlled binding conditions

  • Cross-linking studies:

    • In vivo cross-linking of proteins in C. jejuni

    • Purification of Cj0865-containing complexes

    • Identification of cross-linked partners

    • Advantages: Captures transient interactions; preserves spatial relationships

  • Surface plasmon resonance:

    • Immobilization of purified Cj0865

    • Measurement of binding kinetics with candidate interacting proteins

    • Advantages: Provides quantitative binding parameters; no labels required

These approaches would help identify:

  • Potential substrates of Cj0865's oxidoreductase activity

  • Other components of the disulfide bond formation pathway

  • Regulatory proteins that modulate Cj0865 function

  • Unexpected interaction partners suggesting novel functions

What strategies can overcome difficulties in expressing soluble, active recombinant Cj0865?

Expressing recombinant disulfide-containing proteins presents specific challenges due to their redox-sensitive nature. Based on established protocols for similar proteins, researchers should consider:

Table 3: Troubleshooting Strategies for Recombinant Cj0865 Expression

ChallengePotential SolutionsRationale
Insoluble protein expressionUse periplasmic expression systemsNative environment for disulfide formation
Lower induction temperature (16-20°C)Slows protein folding, reducing aggregation
Fusion to solubility tags (MBP, SUMO)Enhances solubility
Incorrect disulfide formationCo-expression with DsbA/DsbCProvides native folding machinery
Addition of glutathione redox bufferCreates appropriate redox environment
Expression in specialized strains (Origami)Enhances disulfide formation
Loss of activity during purificationInclude reducing agents selectivelyPrevents non-specific oxidation
Rapid purification at low temperatureMinimizes denaturation
Buffer optimizationMaintains native conformation
Low yieldCodon optimization for expression hostImproves translation efficiency
Use of stronger promotersIncreases transcription
High cell-density fermentationMaximizes biomass

Experimental workflow:

  • Transform expression construct into multiple host strains

  • Test expression under various conditions (temperature, inducer concentration, duration)

  • Compare protein solubility using SDS-PAGE analysis of soluble vs. insoluble fractions

  • Optimize lysis and purification conditions to maintain activity

  • Verify proper folding through activity assays and circular dichroism

How can researchers address conflicting phenotypic data when characterizing Cj0865 mutants?

When confronted with inconsistent or contradictory phenotypic data from Cj0865 mutant studies, a systematic approach is required:

  • Confirm mutant construction:

    • Verify the mutation by sequencing

    • Check for polar effects on neighboring genes using RT-PCR

    • Ensure no secondary mutations by whole genome sequencing

  • Validate complementation:

    • Confirm expression of complementing gene by RT-PCR and Western blot

    • Use controlled expression systems to prevent artifacts from overexpression

    • Consider chromosomal reintegration vs. plasmid-based complementation

  • Standardize experimental conditions:

    • Control for growth phase effects by standardizing OD600 of bacterial suspensions

    • Minimize batch-to-batch variation in media composition

    • Include multiple biological and technical replicates

    • Blind sample analysis where possible

  • Consider strain background effects:

    • Test mutation in multiple C. jejuni strains

    • Compare with published data on related genes (other dsb genes)

    • Evaluate potential epistatic interactions with other genes

  • Expand phenotypic analysis:

    • Employ multiple complementary assays for each phenotype

    • Test under various environmental conditions

    • Look for subtle phenotypes using sensitive detection methods

  • Molecular approaches to resolve conflicts:

    • Transcriptomics to identify compensatory gene expression

    • Metabolomics to detect pathway alterations

    • Suppressor screens to identify interacting genes

Statistical analysis should be employed to determine significance of observed differences , and both positive and negative results should be reported with appropriate context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.