Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative zinc metalloprotease Cj1068 (Cj1068)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cj1068; Putative zinc metalloprotease Cj1068
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
Cj1068
Target Protein Sequence
MRSLLLLIVILILGIKFYSIEFLATVLVISFLIFFHELGHFLAARSLGVKVEVFSIGFGK SLIEREFKGTNYRLSTLPLGGYVKLKGQDDMRPGFENLDKDSYSILSPLKKIYILFAGPF FNLILAFFLYIIIGNLGLNKLAPQIGNIAPNSAAQEIGLQKNDTILEINGIRIQTFDEIS KHLSLDPLKILINREGKNLEFILTPKIGQGYNDFGQIVEKPQLGVSPNGTSTLVKHQGLE SFKYAAQESFQASTLIIKGIVKLISGEVEAKNLGGIITMTEITSKAAQNSFTLLLFITAL ISINLGILNLLPIPMLDGGHILFNLYEMIFRRKVPQRTFEYLSYTGMAILLSLMLFATYN DISRIIGE
Uniprot No.

Target Background

Database Links

KEGG: cje:Cj1068

STRING: 192222.Cj1068

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni putative zinc metalloprotease Cj1068?

Cj1068 is a putative zinc metalloprotease found in Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168). It belongs to the broader family of zinc-dependent proteolytic enzymes that require zinc as a cofactor for their catalytic activity. As a putative zinc metalloprotease, Cj1068 is believed to play a role in protein degradation and potentially contributes to C. jejuni pathogenesis, though its specific substrates and complete functional characterization remain areas of active investigation .

How does Cj1068 compare to other zinc-dependent proteins in C. jejuni?

C. jejuni possesses several zinc-dependent proteins, with the zinc ABC transport system being one of the best characterized. While Cj1068 functions as a putative zinc metalloprotease, the ZnuA protein (Cj0143c) serves as the periplasmic component of a zinc ABC transport system encoded together with Cj0142c and Cj0141c. Unlike Cj1068, ZnuA has been extensively characterized and is known to be essential for C. jejuni growth in zinc-limiting conditions and for successful colonization of the chick gastrointestinal tract. ZnuA is also known to be glycosylated at asparagine 28, though this modification is not essential for its function .

What is known about the domain structure of Cj1068?

Cj1068 consists of 368 amino acids and likely contains the canonical HEXXH motif that coordinates zinc binding in metalloproteases. This motif typically forms part of the active site where two histidine residues coordinate with the zinc ion, while the glutamic acid residue participates in the catalytic mechanism. Further structural characterization through X-ray crystallography or cryo-electron microscopy would provide valuable insights into its three-dimensional structure and functional domains .

How is zinc coordination achieved in Cj1068?

Zinc coordination in metalloproteases like Cj1068 typically involves the HEXXH motif mentioned above, plus an additional amino acid (often glutamic acid or histidine) positioned elsewhere in the sequence. This creates a tetrahedral coordination geometry around the zinc ion. The precise coordination structure for Cj1068 has not been definitively established in the literature, but computational structural modeling based on homologous proteins could provide preliminary insights.

What experimental approaches can determine substrate specificity of Cj1068?

To determine substrate specificity of Cj1068, researchers should consider:

  • Synthetic peptide libraries: Testing the activity of purified recombinant Cj1068 against diverse peptide substrates with different amino acid sequences

  • Proteomics-based identification: Using techniques like TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify proteolytic cleavage events in C. jejuni lysates with and without active Cj1068

  • Comparative analysis with host proteins: Examining whether host proteins involved in immune response or epithelial barrier function are cleaved by Cj1068

These approaches should be conducted both in vitro with purified components and in cellular infection models to validate physiological relevance.

What expression systems are most effective for producing recombinant Cj1068?

Recombinant Cj1068 can be expressed using several systems, each with distinct advantages:

Expression SystemAdvantagesChallengesYield Estimates
E. coliRapid growth, high yields, simple manipulationPotential improper folding, lack of glycosylation5-10 mg/L culture
YeastBetter protein folding, some post-translational modificationsLonger production time, more complex media2-5 mg/L culture
BaculovirusComplex eukaryotic processing, higher-order foldingTechnical complexity, higher cost1-3 mg/L culture
Mammalian CellMost authentic post-translational modificationsLowest yields, highest cost0.5-2 mg/L culture

For initial characterization studies, E. coli systems typically provide sufficient yields of functional protein, though care must be taken to optimize solubility through fusion tags or modified induction conditions .

What purification strategy yields the highest purity of active Cj1068?

A recommended purification strategy for Cj1068 would include:

  • Affinity chromatography: Using a His-tag or FLAG-tag approach similar to that employed for ZnuA purification

  • Size exclusion chromatography: To separate properly folded monomeric protein from aggregates

  • Ion exchange chromatography: As a polishing step to remove contaminants

  • Addition of zinc during purification: Including 10-50 μM ZnCl₂ in buffers to maintain metalloprotease activity

This multi-step approach typically yields >95% pure protein with preserved enzymatic activity. Verification of zinc binding can be performed using methods similar to those employed for FLAG-tagged Cj0143c, which has been shown to bind zinc in vitro .

How can researchers develop a reliable assay for measuring Cj1068 proteolytic activity?

A robust assay for Cj1068 proteolytic activity should include:

  • Fluorogenic peptide substrates: Peptides containing a quencher-fluorophore pair that fluoresces upon cleavage

  • Zinc-dependency verification: Activity measurement in the presence of EDTA (chelator) versus excess zinc

  • pH and temperature optimization: Testing activity across physiologically relevant ranges

  • Kinetic parameters determination: Establishing Km and Vmax values for identified substrates

  • Inhibitor profiling: Testing sensitivity to various metalloprotease inhibitors

Control experiments should include heat-inactivated enzyme and site-directed mutants of the putative catalytic residues to confirm specificity.

What is the relationship between Cj1068 and C. jejuni virulence?

To investigate the relationship between Cj1068 and virulence, researchers should consider:

  • Construction of cj1068 deletion mutants: Comparing colonization efficiency in poultry models

  • Epithelial cell infection models: Measuring adherence, invasion, and cytotoxicity

  • Immunomodulation studies: Assessing effects on host inflammatory responses

  • Comparative genomics: Analyzing cj1068 sequence variation across clinical isolates with different virulence profiles

Preliminary research indicates zinc-related proteins are important for C. jejuni colonization, as demonstrated by ZnuA being essential for chick gastrointestinal tract colonization .

How might Cj1068 interact with the host immune system?

Host-pathogen interactions involving Cj1068 may include:

  • Degradation of antimicrobial peptides: Potentially cleaving host defensins

  • Modification of immune signaling: Possible proteolytic processing of cytokines or receptors

  • Evasion of complement: Potential cleavage of complement components

  • Alteration of extracellular matrix: Modifying host tissue architecture

These interactions could be studied using recombinant Cj1068 incubated with purified host factors, followed by mass spectrometry analysis of cleavage products.

What are the implications of sequence variations in Cj1068 across different C. jejuni strains?

Sequence variations in Cj1068 across C. jejuni strains may have significant implications for protein function and bacterial fitness. Similar to studies on zinc metalloprotease mutations in Clostridioides difficile, researchers can conduct multiple sequence alignment of Cj1068 from different isolates to identify regions with high mutation rates . These variations might affect:

  • Substrate specificity and catalytic efficiency

  • Protein stability and expression levels

  • Interactions with host proteins

  • Antigenic properties relevant to host immune recognition

Researchers should collect all available Cj1068 sequences from databases, align them using tools like Clustal Omega, and analyze conservation patterns, especially around the catalytic site and substrate-binding regions.

How do zinc concentration fluctuations affect Cj1068 expression and activity?

Zinc homeostasis significantly impacts bacterial metalloproteases. In C. jejuni, the znuABC genes (encoding zinc transport components) show zinc-dependent transcription . For Cj1068, researchers should investigate:

  • Transcriptional regulation: Quantitative PCR analysis of cj1068 expression under varying zinc concentrations

  • Protein stability: Western blot analysis of Cj1068 levels under zinc limitation

  • Enzymatic activity: Measuring proteolytic activity as a function of zinc availability

  • Competitive inhibition: Effects of other divalent metals on Cj1068 function

Understanding these relationships could reveal how zinc availability in different host niches affects virulence factor expression.

What technical challenges exist in crystallizing Cj1068 for structural studies?

Crystallizing zinc metalloproteases presents several challenges:

  • Protein flexibility: Dynamic regions may impede crystal formation

  • Metal ion heterogeneity: Variable zinc occupancy can create structural heterogeneity

  • Solubility issues: Membrane association may reduce solubility

  • Proteolytic activity: Self-cleavage during crystallization

Potential solutions include:

  • Creating catalytically inactive mutants (e.g., E→A substitution in the HEXXH motif)

  • Co-crystallization with specific inhibitors

  • Truncation constructs removing flexible regions

  • Fusion to crystallization chaperones like T4 lysozyme

How might Cj1068 serve as a target for novel antimicrobial strategies?

Potential antimicrobial strategies targeting Cj1068 include:

  • Small-molecule inhibitors: Developing specific metalloprotease inhibitors that bind the active site

  • Peptide-based inhibitors: Designing uncleavable substrate analogs

  • Allosteric modulators: Targeting regulatory sites that affect enzyme conformation

  • Zinc-sequestration approaches: Limiting available zinc to reduce metalloprotease activity

The development pathway should include in silico screening, biochemical verification, cellular activity testing, and animal model efficacy studies.

What genomic approaches could enhance our understanding of Cj1068 regulation?

Advanced genomic approaches for studying Cj1068 regulation include:

  • ChIP-seq: Identifying transcription factors that bind the cj1068 promoter region

  • RNA-seq: Profiling transcriptional changes under various conditions

  • Ribosome profiling: Measuring translational efficiency

  • CRISPRi: Targeted repression to study gene function without complete deletion

  • CRISPR-based reporters: Monitoring promoter activity in real-time during infection

These approaches would help elucidate the regulatory networks controlling Cj1068 expression during pathogenesis.

How does the host microbiome influence the expression and activity of Cj1068?

The host microbiome may influence Cj1068 through:

  • Competition for zinc: Other microbiota members may alter zinc availability

  • Metabolite production: Small molecules from commensals might modulate enzyme activity

  • Physical interactions: Biofilm formation might affect protease accessibility to substrates

  • Immune modulation: Microbiome effects on host immunity could indirectly impact C. jejuni virulence gene expression

Research approaches should include gnotobiotic animal models, microbiome sequencing, and metabolomics to understand these complex interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.