Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Uncharacterized protein Cj0236c (Cj0236c)

Shipped with Ice Packs
In Stock

Description

Putative Roles in Pathogenesis

  • Adhesion and Invasion: While Cj0236c itself is uncharacterized, homologs like Cj0268c (sharing structural domains) are critical for C. jejuni adhesion to host cells. Cj0268c contains an SPFH domain linked to lipid raft formation and cell wall stability, suggesting Cj0236c may share similar roles in host-pathogen interactions .

  • Apoptosis Regulation: In silico analyses predict Cj0236c inhibits apoptosis, potentially aiding bacterial evasion of host immune responses .

  • Transport Activity: COG and PFAM annotations suggest it may function as an ATP-binding cassette (ABC) transporter, though experimental validation is pending .

Comparative Genomic Analysis

Cj0236c is ubiquitous in C. jejuni genomes, but its sequence conservation varies. WebLogo analysis reveals conserved hydrophobic and polar residues in its central region, hinting at structural or functional importance .

Vaccine Development

  • Recombinant Cj0236c is marketed as a vaccine ingredient (e.g., VAng-Ly2055) for preclinical studies, leveraging its immunogenic potential .

  • Key Studies:

    • Heterologous expression in E. coli demonstrated enhanced bacterial adhesion to epithelial cells, implicating Cj0236c in virulence mechanisms .

    • PSORTb localization predictions (cytoplasmic membrane) align with roles in cell wall integrity, a target for novel antimicrobials .

Antibiotic Resistance Context

While Cj0236c is not directly linked to resistance, C. jejuni strains often harbor plasmids carrying virulence factors like tet(O) and CRISPR-associated genes, which may co-evolve with membrane proteins like Cj0236c .

Ongoing Research Gaps

  • Mechanistic Role: The exact function of Cj0236c in adhesion, apoptosis, or transport requires targeted mutagenesis and proteomic studies.

  • Structural Biology: No resolved 3D structure exists; crystallography or cryo-EM could elucidate binding motifs.

  • Host-Specificity: Strain NCTC 11168 infects humans and poultry, but Cj0236c’s contribution to host tropism is unverified .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Cj0236c; Uncharacterized protein Cj0236c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
Cj0236c
Target Protein Sequence
MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAYVGIFALASFFIQSQV TFWILFAVEIGLLFALQWKKREAPLNLVLLFGFTFCSGLTLTPLLISVLALPAGGIIIAQ AFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLLNLFFQSSIVNLAISAVA AILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLLNILRSFNSR
Uniprot No.

Target Background

Database Links

KEGG: cje:Cj0236c

STRING: 192222.Cj0236c

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the basic structure of Cj0236c protein from Campylobacter jejuni?

Cj0236c is an uncharacterized protein from Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168). The protein consists of 231 amino acids (aa 1-231) and has been produced recombinantly for research purposes. While detailed structural characterization remains limited, the protein can be expressed in various systems including E. coli, yeast, baculovirus, or mammalian cells for further analysis . Preliminary structural analyses would typically involve techniques such as circular dichroism spectroscopy, X-ray crystallography, or nuclear magnetic resonance spectroscopy to determine secondary and tertiary structures.

How does Cj0236c fit into the broader context of C. jejuni as a pathogen?

Campylobacter jejuni is a Gram-negative, spiral-shaped, microaerophilic bacterium with a single polar flagellum. It is one of the most common causes of bacterial gastroenteritis worldwide, often associated with consumption of contaminated poultry products . Given that C. jejuni naturally colonizes the digestive tract of many bird species, proteins like Cj0236c may play roles in adaptation to host environments or virulence mechanisms. Understanding Cj0236c within this context requires consideration of C. jejuni's physiological adaptations, including its ability to transform into a coccal form when exposed to atmospheric oxygen and its preference for anaerobic regions of the intestine where it utilizes a branched respiratory chain for energy .

What expression systems are most effective for recombinant production of Cj0236c?

While Cj0236c can be expressed in various systems including E. coli, yeast, baculovirus, or mammalian cells , the optimal system depends on research requirements. The comparative advantages of different expression systems are summarized in the following table:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, rapid growth, low costLimited post-translational modificationsInitial structural studies, antibody production
YeastModerate yield, eukaryotic modificationsLonger production timeFunctional studies requiring proper folding
BaculovirusComplex protein processing, high yieldTechnical complexity, longer timelineStructural biology, protein-protein interactions
MammalianNative-like modificationsHighest cost, lowest yieldFunctional assays, cell-based experiments

Selection should be based on experimental objectives, with E. coli systems typically providing sufficient material for preliminary characterization. For functional studies where post-translational modifications may be critical, eukaryotic systems might be preferable.

What is the recommended experimental design for investigating potential functions of uncharacterized proteins like Cj0236c?

A robust experimental design for investigating uncharacterized proteins like Cj0236c should typically follow a systematic approach combining in silico analysis with wet-lab validation. Begin with bioinformatic approaches including sequence homology searches, domain prediction, and phylogenetic analysis to generate functional hypotheses. Follow with targeted gene knockout or knockdown experiments to examine phenotypic changes in C. jejuni.

For experimental validation, a full factorial design examining multiple conditions is recommended. For instance, a 3×2 design (three levels of protein expression × two environmental conditions) allows for examination of interaction effects . A systematic workflow would include:

  • Bioinformatic prediction of function

  • Generation of deletion mutants and complemented strains

  • Phenotypic characterization (growth curves, stress resistance, host cell interaction)

  • Biochemical characterization (substrate binding, enzymatic activity)

  • Structural studies to confirm predicted domains

Within-subjects designs are particularly valuable for controlling individual variation in bacterial cultures, though between-subjects designs may be necessary when examining irreversible treatments or modifications .

How can researchers effectively generate and validate Cj0236c knockout mutants in C. jejuni?

Generating Cj0236c knockout mutants requires careful consideration of C. jejuni's specific genetic properties. An effective methodological approach involves:

  • Construct Design: Create a knockout construct containing an antibiotic resistance cassette (typically kanamycin or chloramphenicol) flanked by 500-1000bp homologous regions upstream and downstream of cj0236c.

  • Transformation: Natural transformation is often effective for C. jejuni, using biphasic method on non-selective media followed by selective media containing appropriate antibiotics.

  • Verification: Confirm successful knockouts through both PCR verification (with primers spanning the insertion site) and sequencing. Western blotting with antibodies against Cj0236c provides protein-level confirmation.

  • Complementation: Generate a complemented strain by reintroducing the wild-type gene at a neutral site in the chromosome or on a compatible plasmid to confirm phenotypic changes are due specifically to Cj0236c deletion.

  • Phenotypic Characterization: Compare growth rates, colony morphology, and stress responses between wild-type, mutant, and complemented strains.

This approach mirrors successful mutation strategies used for other C. jejuni genes like cj1136, where knockout mutants showed specific phenotypic changes in virulence characteristics .

How might Cj0236c contribute to C. jejuni pathogenesis based on comparative analysis with characterized virulence factors?

While Cj0236c remains uncharacterized, comparative analysis with known C. jejuni virulence factors provides insights into potential roles in pathogenesis. Drawing parallels from characterized proteins such as Cj1136 (a galactosyltransferase involved in lipooligosaccharide biosynthesis), several hypotheses emerge:

  • Host Cell Invasion: Like Cj1136, which affects invasion into intestinal epithelial cells when disrupted , Cj0236c may contribute to C. jejuni's invasive capacity. Research methodology should include gentamicin protection assays with INT-407 and Caco-2 cell lines comparing wild-type and cj0236c mutant strains.

  • Surface Structure Biosynthesis: Many uncharacterized C. jejuni proteins contribute to lipooligosaccharide (LOS) or capsular polysaccharide synthesis, affecting immune evasion. Phenotypic analysis should include silver staining of LOS profiles and surface hydrophobicity assays.

  • Stress Response: C. jejuni encounters various stresses during infection. Testing cj0236c mutants for sensitivity to bile salts, oxidative stress, and antimicrobial peptides (similar to increased polymyxin B sensitivity in cj1136 mutants ) would reveal potential roles in stress adaptation.

  • Colonization Capacity: In vivo colonization models (particularly 1-day-old chick models) have successfully demonstrated colonization defects in other C. jejuni mutants and would be appropriate for evaluating Cj0236c's role in host colonization.

Methodological approaches should include controlled comparisons between wild-type, mutant, and complemented strains across these phenotypic assays.

What methods are most appropriate for investigating Cj0236c's potential involvement in respiratory pathways of C. jejuni?

Given C. jejuni's reliance on respiratory metabolism for energy generation, investigating Cj0236c's potential role in respiratory pathways requires specific methodological approaches:

  • Oxygen Consumption Assays: Measure oxygen uptake rates in wild-type and cj0236c mutant strains using oxygen electrodes when provided with various respiratory substrates (formate, hydrogen, α-ketoglutarate) .

  • Electron Transport Chain Analysis: Evaluate cytochrome oxidation states using spectrophotometric methods to determine if Cj0236c affects electron flow through the respiratory chain.

  • Alternative Electron Acceptor Utilization: Assess growth of cj0236c mutants under anaerobic conditions with various electron acceptors (nitrate, DMSO, fumarate) to determine if Cj0236c functions in specific respiratory branches .

  • Enzyme Activity Assays: Measure activities of key respiratory enzymes (formate dehydrogenase, hydrogenase, 2-oxoglutarate:acceptor oxidoreductase) in membrane fractions from wild-type and mutant strains .

  • Transcriptional Analysis: Perform RT-qPCR to examine expression changes in respiratory genes when cj0236c is deleted.

These approaches parallel successful methodologies used to characterize respiratory components in C. jejuni, including hydrogenase, formate dehydrogenase, and modified complex I .

How can researchers address contradictory data in Cj0236c functional studies?

When encountering contradictory data in functional studies of Cj0236c, a systematic troubleshooting approach is essential:

  • Strain Variability Analysis: Different C. jejuni strains may show varied phenotypes due to genomic differences. Conduct comparative genomics of the cj0236c region across multiple reference strains (NCTC 11168, 81-176, 81116) to identify strain-specific genetic contexts.

  • Growth Condition Standardization: C. jejuni's microaerophilic nature makes reproducibility challenging. Implement strict standardization of:

    • Atmospheric conditions (precisely defined O₂ and CO₂ percentages)

    • Growth phase of cultures (early-log vs. mid-log vs. stationary)

    • Media composition (including trace elements that may affect specific metabolic pathways)

  • Technical Validation Framework: Employ multiple complementary techniques to validate findings:

    • Confirm gene deletion by both PCR and whole-genome sequencing

    • Verify protein absence by both Western blot and mass spectrometry

    • Assess phenotypes using both in vitro and in vivo models

  • Statistical Robustness: Apply rigorous statistical approaches:

    • Determine appropriate sample sizes through power analysis

    • Use mixed-effects models to account for biological and technical variation

    • Implement Bayesian approaches for integrating prior knowledge with new data

By applying this comprehensive framework, researchers can better identify whether contradictions stem from technical issues, biological variability, or genuine complexity in Cj0236c function.

What advanced proteomic approaches can reveal interaction partners of Cj0236c?

To comprehensively identify Cj0236c interaction partners, researchers should implement a multi-layered proteomic strategy:

  • Affinity Purification-Mass Spectrometry (AP-MS): Using epitope-tagged Cj0236c (His, FLAG, or Strep tag), perform pull-down experiments followed by mass spectrometric identification of co-purifying proteins. Critical controls include:

    • Parallel processing of untagged strains

    • Reverse immunoprecipitation of identified partners

    • Quantitative comparison using SILAC labeling

  • Proximity-Dependent Biotin Identification (BioID): Fuse Cj0236c to a promiscuous biotin ligase (BirA*) which biotinylates proximal proteins, enabling identification of transient or weak interactions that might be missed by AP-MS.

  • Cross-Linking Mass Spectrometry (XL-MS): Apply chemical crosslinkers to stabilize protein complexes before purification, followed by specialized MS analysis to identify crosslinked peptides, providing spatial constraints for interaction modeling.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Compare hydrogen-deuterium exchange rates between Cj0236c alone and in complex with putative partners to map interaction interfaces with high resolution.

  • Protein Microarrays: Screen a C. jejuni proteome array with purified Cj0236c to identify direct binding partners in a high-throughput manner.

These techniques can be integrated into a decision tree workflow, starting with AP-MS for initial candidate identification, followed by validation and structural characterization using the more specialized techniques.

How does research on Cj0236c contribute to understanding broader mechanisms of bacterial pathogenesis?

Research on uncharacterized proteins like Cj0236c contributes significantly to understanding bacterial pathogenesis through several mechanisms:

  • Novel Virulence Mechanisms: Characterization of Cj0236c may reveal previously unknown virulence strategies employed by C. jejuni. For example, if Cj0236c plays a role in LOS biosynthesis similar to Cj1136 , it would contribute to understanding how surface structure modifications affect host-pathogen interactions.

  • Comparative Genomics Insights: Analyzing Cj0236c homologs across bacterial species allows for evolutionary tracing of virulence mechanisms. Methodologically, this involves:

    • Multiple sequence alignments across diverse bacterial pathogens

    • Phylogenetic analysis to trace acquisition/loss patterns

    • Correlation of protein presence with virulence phenotypes

  • Host-Pathogen Interface Elucidation: If Cj0236c proves involved in host cell invasion or immune evasion, characterization would reveal mechanisms potentially shared across bacterial pathogens. Research approaches should include:

    • Comparative transcriptomics of host cells infected with wild-type versus cj0236c mutants

    • Immunological assays measuring cytokine profiles and immune cell recruitment

    • Infection models assessing differential tissue tropism

  • One Health Applications: Given C. jejuni's zoonotic nature, understanding Cj0236c has implications across human, animal, and environmental health domains, particularly in modeling transmission dynamics between poultry and human hosts.

These insights require interdisciplinary research approaches combining molecular microbiology, immunology, structural biology, and epidemiology.

What methods should be used to analyze evolutionary conservation of Cj0236c across Campylobacter species and beyond?

A robust evolutionary analysis of Cj0236c requires a multi-tiered methodological approach:

  • Sequence-Based Phylogenetic Analysis:

    • Retrieve homologous sequences using PSI-BLAST and HMM-based searches

    • Perform multiple sequence alignment using MAFFT or T-Coffee algorithms

    • Construct phylogenetic trees using maximum likelihood methods with appropriate substitution models

    • Calculate selection pressures using dN/dS ratios to identify conserved functional domains

  • Structural Conservation Analysis:

    • Generate structural models of Cj0236c homologs using AlphaFold2 or RoseTTAFold

    • Perform structural alignments to identify conserved binding pockets or catalytic sites

    • Analyze electrostatic surface potential conservation across homologs

  • Genomic Context Analysis:

    • Examine conservation of gene neighborhood across species

    • Identify co-evolving gene pairs through correlation analysis

    • Map horizontal gene transfer events using reconciliation of gene and species trees

  • Experimental Functional Conservation:

    • Test functional complementation of cj0236c mutants with homologs from other species

    • Compare biochemical activities of recombinant homologs

    • Analyze expression patterns of homologs under similar conditions

This comprehensive approach provides a evolutionary framework for understanding Cj0236c function and can guide experimental design by highlighting conserved features likely to be functionally significant.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.