Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Undecaprenyl-diphosphatase (uppP)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 undecaprenyl-diphosphatase, commonly referred to as uppP, is an enzyme that plays a crucial role in the bacterial glycosylation process. This enzyme is involved in the biosynthesis of undecaprenyl pyrophosphate, a lipid carrier essential for the transfer of sugar moieties during the synthesis of glycoproteins and lipopolysaccharides in Campylobacter jejuni, a significant pathogen associated with gastrointestinal diseases in humans.

Characteristics of Campylobacter jejuni

Campylobacter jejuni is a Gram-negative, microaerophilic bacterium that is spiral-shaped and non-spore-forming. It is one of the leading causes of bacterial gastroenteritis worldwide, primarily transmitted through contaminated poultry and water. The organism's ability to adapt to various environmental conditions contributes to its pathogenicity and virulence.

Key Features:

  • Morphology: Spiral-shaped, motile rods with a single polar flagellum.

  • Oxygen Requirement: Microaerophilic; thrives in low oxygen environments.

  • Pathogenicity: Causes gastroenteritis, with symptoms including diarrhea, abdominal pain, and fever.

Function of Undecaprenyl-diphosphatase (uppP)

The uppP gene encodes undecaprenyl-diphosphatase, which catalyzes the hydrolysis of undecaprenyl diphosphate (Und-PP) into undecaprenyl phosphate (Und-P). This reaction is vital for maintaining the balance of lipid carriers within the bacterial cell membrane and facilitating the glycosylation of proteins.

Biochemical Reaction:

Und-PPuppPUnd-P+Pi\text{Und-PP} \xrightarrow{\text{uppP}} \text{Und-P} + \text{Pi}

This enzymatic activity is crucial for the synthesis of glycoproteins and contributes to the structural integrity of the bacterial cell wall.

Research Findings on uppP

Recent studies have focused on the cloning and expression of recombinant uppP from Campylobacter jejuni to explore its potential applications in vaccine development and as a target for antimicrobial agents.

Applications of Recombinant uppP

The recombinant form of uppP can be utilized in various biotechnological applications:

  • Vaccine Development: The recombinant protein can serve as an antigen for vaccine formulation against C. jejuni infections.

  • Diagnostic Tools: The enzyme's activity can be measured to develop diagnostic assays for detecting C. jejuni infections.

  • Antimicrobial Target: Understanding the mechanism of action can lead to novel antimicrobial strategies targeting bacterial glycosylation pathways.

References

  1. Creative Biolabs - Recombinant Campylobacter Jejuni uppP Protein.

  2. PMC Article - In vitro assembly of undecaprenylpyrophosphate-linked glycosylation pathways.

  3. PMC Article - Pathogenicity and virulence factors of Campylobacter jejuni.

  4. PMC Article - Expression studies on recombinant proteins from Campylobacter jejuni.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its use in production.
Synonyms
uppP; bacA; upk; Cj0205; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
uppP
Target Protein Sequence
MENLYALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLEFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLGNANSLIPLGIGFITAFIVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links

KEGG: cje:Cj0205

STRING: 192222.Cj0205

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) in Campylobacter jejuni?

Undecaprenyl-diphosphatase (uppP) in Campylobacter jejuni is an essential enzyme involved in bacterial cell wall biosynthesis. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as a critical carrier lipid for bacterial cell wall components. In C. jejuni, uppP plays a crucial role in the glycosylation pathways, particularly in the N-linked protein glycosylation system where undecaprenyl phosphate serves as a carrier for the cytosolic addition of UDP-activated oligosaccharides, similar to dolichyl-phosphate in eukaryotes . This enzyme forms part of the bacterial machinery that enables the synthesis and assembly of complex bacterial oligosaccharides that are essential for cell wall integrity and bacterial survival.

The recombinant version of C. jejuni uppP (particularly from strain 81-176) has been produced for research purposes, with the protein covering amino acids 1-267, suggesting the full-length protein is approximately 267 amino acids long . Various expression systems including E. coli, yeast, baculovirus, or mammalian cells have been used to produce this recombinant protein for structural and functional studies .

What is the role of uppP in bacterial cell wall biosynthesis?

In bacterial cell wall biosynthesis, uppP plays a fundamental role in recycling the lipid carrier undecaprenyl pyrophosphate. The enzyme catalyzes the removal of a phosphate group from undecaprenyl pyrophosphate (UndPP) to form undecaprenyl phosphate (UndP). This UndP is an essential carrier lipid that serves as a membrane anchor for the assembly of various cell wall components including peptidoglycan, lipopolysaccharides, and capsular polysaccharides.

In C. jejuni specifically, UndP functions analogously to dolichyl-phosphate in eukaryotes, serving as a carrier for the cytosolic addition of UDP-activated oligosaccharides in the N-linked protein glycosylation system . This recycling of the lipid carrier is essential for continuous cell wall synthesis and bacterial growth, making uppP a critical enzyme in bacterial physiology. The lipid carrier cycle begins with UndP accepting the initial sugar moiety from a UDP-activated sugar donor, followed by sequential addition of additional sugars. After the assembled oligosaccharide is transferred to its final destination, UndPP is released and must be dephosphorylated by uppP to regenerate UndP for another round of synthesis.

How does uppP contribute to C. jejuni glycosylation processes?

The uppP enzyme contributes significantly to C. jejuni glycosylation processes by generating undecaprenyl phosphate (UndP), which serves as the lipid carrier for oligosaccharide assembly. C. jejuni possesses both O-linked and N-linked protein glycosylation systems . The N-linked protein glycosylation system is carried out by the pgl locus consisting of 11 genes (pglA-F, pglH-K and gne) . In this pathway, UndP serves as a carrier for the cytosolic addition of UDP-activated oligosaccharides.

The role of uppP is to generate UndP from UndPP, thereby providing the essential lipid carrier that allows for the assembly of oligosaccharides that will be transferred to proteins. In the N-linked glycosylation pathway, PglC transfers UDP-bacillosamine to UndP, which is produced by the action of uppP. This initiates the assembly of the heptasaccharide that will eventually be transferred to asparagine residues on target proteins by the oligosaccharyltransferase PglB. The proper functioning of this pathway is critical for various aspects of C. jejuni physiology, including protein folding, stability, and host-pathogen interactions.

What are the structural characteristics of C. jejuni uppP?

Based on available research data, recombinant C. jejuni uppP protein has been produced covering amino acids 1-267 from strain 81-176, indicating that the full-length protein is approximately 267 amino acids . As a membrane-associated enzyme responsible for processing the lipid carrier undecaprenyl pyrophosphate, uppP likely contains transmembrane domains that anchor it to the bacterial membrane.

While specific structural details of C. jejuni uppP are not explicitly described in the provided search results, we can infer certain characteristics based on related bacterial undecaprenyl-diphosphatases. These enzymes typically belong to the phosphatidic acid phosphatase (PAP2) superfamily and often have multiple transmembrane domains with active sites oriented toward the periplasmic space. The enzyme likely possesses a catalytic site containing a conserved phosphatase motif necessary for the dephosphorylation reaction.

The optimal expression of recombinant C. jejuni uppP can be achieved using various host systems including E. coli, yeast, baculovirus, or mammalian cells . This versatility in expression systems suggests that the protein may be amenable to structural studies using techniques such as X-ray crystallography or cryo-electron microscopy, which could provide detailed insights into its three-dimensional structure and catalytic mechanism.

What methods can be used to express and purify recombinant C. jejuni uppP?

Expression and purification of recombinant C. jejuni uppP requires careful consideration of expression systems and purification strategies due to its likely membrane-associated nature. Based on available information, recombinant C. jejuni uppP protein (aa 1-267) from strain 81-176 can be produced using several expression systems, including E. coli, yeast, baculovirus, or mammalian cell expression systems .

The purification strategy typically involves the following steps:

  • Cell lysis and membrane fraction isolation by differential centrifugation

  • Membrane solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, DDM)

  • Affinity chromatography using tags such as His6 or GST fused to the recombinant protein

  • Size exclusion chromatography for further purification and detergent exchange

  • Protein quality assessment by SDS-PAGE, Western blotting, and activity assays

Table 1. Comparison of Expression Systems for Recombinant C. jejuni uppP

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliRapid growth, high yield, cost-effectivePotential misfolding, inclusion bodiesLow temperature, specialized strains, fusion tags
YeastEukaryotic folding, post-translational modificationsLonger growth time, hyperglycosylationCodon optimization, signal sequence selection
BaculovirusGood for complex proteins, high expressionMore time-consuming, technically complexOptimize MOI, harvest time, cell line selection
Mammalian cellsNative-like folding and modificationsMost expensive, lower yieldsStable cell line development, optimized transfection

The choice of expression system should be guided by the specific requirements of the research and the intended applications of the recombinant uppP protein.

How can the enzymatic activity of recombinant uppP be measured in vitro?

Several biochemical approaches can be employed to measure the enzymatic activity of recombinant C. jejuni uppP in vitro. Since uppP catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate with the release of inorganic phosphate, assays typically focus on quantifying either phosphate release or product formation.

The following methodological approaches can be used:

  • Direct measurement of phosphate release:

    • Colorimetric assays such as the malachite green assay, which detects free inorganic phosphate through a color change measurable by spectrophotometry

    • EnzChek Phosphate Assay Kit, which uses enzymatic coupling to produce a fluorescent signal proportional to phosphate concentration

  • Radiolabeled substrate assays:

    • Using [32P]-labeled undecaprenyl pyrophosphate as a substrate

    • Measuring the release of [32P]orthophosphate by scintillation counting

    • Separating substrate and product by thin-layer chromatography or extraction methods

  • Chromatographic analysis:

    • HPLC or LC-MS methods to directly quantify the substrate (undecaprenyl pyrophosphate) and product (undecaprenyl phosphate)

    • Requires appropriate standards and detection methods (UV, MS)

  • Pathway-based assays:

    • Based on the pathway-screening approach described for C. jejuni N-glycosylation enzymes, uppP activity could be incorporated into a multicomponent assay

    • This might involve monitoring the transfer of radiolabeled sugars ([3H]GalNAc) from water-soluble UDP carriers to lipophilic acceptors that depend on uppP activity

For kinetic characterization, experiments should be designed to determine key parameters including Km, Vmax, and kcat under various conditions (pH, temperature, divalent cation requirements). Inhibition studies can also be performed by including potential inhibitors in the reaction and determining their effect on enzyme activity.

What is the relationship between uppP activity and C. jejuni pathogenicity?

The relationship between uppP activity and C. jejuni pathogenicity can be inferred from the critical role of undecaprenyl phosphate-dependent glycosylation in bacterial virulence. C. jejuni is a major foodborne pathogen and a leading cause of bacterial gastroenteritis in humans, with certain strains associated with post-infection irritable bowel syndrome (PI-IBS) .

Research has shown that specific C. jejuni genotypes confer greater in vitro virulence and increased risk of PI-IBS . While uppP is not specifically mentioned among the genes directly associated with PI-IBS development, the glycosylation pathways that depend on uppP activity are implicated in virulence. For instance, variations in bacterial stress response (Cj0145_phoX), adhesion protein (Cj0628_CapA), and core biosynthetic pathway genes were associated with PI-IBS development .

The N-linked protein glycosylation system, which relies on the undecaprenyl phosphate produced by uppP, affects multiple aspects of C. jejuni biology:

  • Flagellar function and motility: Glycosylation of flagellin is essential for proper flagellar assembly and bacterial motility, which are crucial for colonization

  • Cell adhesion and invasion: Glycoproteins on the bacterial surface mediate interactions with host cells. In vitro assays have demonstrated greater adhesion, invasion, and cytokine (IL-8 and TNFα) secretion from colonocytes with PI-IBS-associated strains compared to non-PI-IBS strains

  • Stress response and survival: Glycosylation may affect bacterial responses to environmental stresses encountered during infection

Given that uppP provides the essential lipid carrier (undecaprenyl phosphate) for these glycosylation processes, its activity likely influences the pathogenicity of C. jejuni. Disruption or inhibition of uppP could potentially affect glycosylation patterns, surface antigen presentation, and interactions with host cells, thereby modulating virulence.

How does uppP interact with other enzymes in the C. jejuni glycosylation pathway?

The uppP enzyme functions as part of an interconnected pathway for bacterial glycosylation, particularly in the N-linked protein glycosylation system of C. jejuni. This system is carried out by the pgl locus consisting of 11 genes (pglA-F, pglH-K and gne) . While specific protein-protein interactions between uppP and other enzymes are not explicitly described in the provided search results, functional relationships can be inferred from the pathway organization.

In the N-linked glycosylation pathway, uppP is functionally connected to several enzymes:

  • PglC: This phosphoglycosyltransferase utilizes the undecaprenyl phosphate (UndP) produced by uppP as a substrate, transferring the first sugar (bacillosamine) from UDP-bacillosamine to UndP .

  • PglD, PglE, and PglF: These enzymes are involved in the conversion of UDP-N-acetyl glucosamine (GlcNAc) to UDP-bacillosamine, which is then used by PglC .

  • PglA and other glycosyltransferases: These enzymes sequentially add additional sugars to the growing oligosaccharide chain anchored to UndP.

A multicomponent kinetic assay has been developed for the early enzymes in the UndPP-heptasaccharide biosynthetic pathway, including PglF, PglE, PglD, PglC, and PglA . This assay monitors the transfer of [3H]GalNAc from the water-soluble UDP carrier to the lipophilic UndPP-diNAcBac acceptor, providing a tool to study the functional relationships between these enzymes .

The timing and coordination of these enzymatic activities are crucial for efficient glycan assembly. While uppP may not physically interact with these enzymes, the product of its enzymatic activity (UndP) serves as a substrate for subsequent steps in the pathway, creating a functional dependency. Understanding these functional relationships is important for developing strategies to modulate C. jejuni glycosylation pathways.

What inhibitors have been developed against C. jejuni uppP and what is their mechanism of action?

While specific inhibitors developed against C. jejuni uppP are not detailed in the provided search results, the importance of developing such inhibitors is highlighted. The search results mention that "a considerable hindrance to studying bacterial N-glycosylation in vivo is the absence of small molecule inhibitors to reversibly control the process" . This suggests that developing uppP inhibitors could provide valuable tools for studying glycosylation processes in C. jejuni.

Potential approaches for uppP inhibitor development might include:

  • Substrate analogs: Compounds that mimic undecaprenyl pyrophosphate but are resistant to dephosphorylation by uppP

  • Phosphate mimetics: Molecules that occupy the active site by mimicking the phosphate group but cannot be processed by the enzyme

  • Allosteric inhibitors: Compounds that bind to sites outside the active site but induce conformational changes that prevent catalysis

  • Transition state analogs: Molecules that mimic the transition state of the dephosphorylation reaction

The mechanism of action for these inhibitors would typically involve:

  • Competitive inhibition by occupying the substrate binding site

  • Non-competitive inhibition through binding to allosteric sites

  • Irreversible inhibition through covalent modification of catalytic residues

The pathway-screening assay described in search result for the early enzymes in the C. jejuni N-linked glycosylation pathway could potentially be adapted to identify inhibitors that target uppP or other enzymes in this pathway. This assay has a Z'-factor calculated to be 0.77, indicating a robust assay suitable for screening . Such screening efforts could lead to the identification of novel inhibitors against C. jejuni uppP, which could serve as research tools or potential leads for antimicrobial development.

What expression systems are optimal for producing functional recombinant C. jejuni uppP?

The optimal expression system for producing functional recombinant C. jejuni uppP depends on several factors including the required protein yield, purity, and intended application. Based on available information, recombinant C. jejuni uppP protein can be produced using various expression hosts including E. coli, yeast, baculovirus, or mammalian cell systems .

For membrane proteins like uppP, special considerations must be taken into account:

  • E. coli expression system:
    This system is often the first choice due to its simplicity, rapid growth, and cost-effectiveness. For membrane proteins like uppP, specialized strains such as C41(DE3) or C43(DE3) that are engineered for membrane protein expression may yield better results. Expression should be performed at lower temperatures (16-20°C) to minimize inclusion body formation. Addition of fusion tags like maltose-binding protein (MBP) or SUMO can enhance solubility.

  • Yeast expression system:
    Yeast systems like Pichia pastoris or Saccharomyces cerevisiae offer advantages for membrane protein expression including eukaryotic processing machinery and high-density cultures. The glycosylation machinery in yeast may differ from bacterial systems, which should be considered if post-translational modifications are important.

  • Baculovirus expression system:
    This system uses insect cells infected with recombinant baculovirus and is well-suited for complex proteins. It offers a eukaryotic environment that may be beneficial for proper folding of membrane proteins, although it is more technically demanding than bacterial systems.

  • Mammalian cell expression system:
    This provides the most native-like environment for protein folding and post-translational modifications but is the most expensive and typically yields lower protein amounts.

For purification of recombinant uppP, a typical workflow would include:

  • Membrane fraction isolation

  • Detergent solubilization

  • Affinity chromatography using appropriate tags (His, GST, etc.)

  • Size exclusion chromatography

The choice of expression system should be guided by the specific requirements of the research, with initial screening of multiple systems recommended to identify the one that produces the highest yield of functional protein.

What assays can be used to characterize uppP enzymatic kinetics?

Characterizing the enzymatic kinetics of uppP requires robust assays that can accurately measure enzyme activity under various conditions. Several methodological approaches can be employed:

  • Phosphate release assays:
    The dephosphorylation of undecaprenyl pyrophosphate by uppP releases inorganic phosphate, which can be quantified using:

    • Malachite green assay: Forms a colored complex with phosphomolybdate

    • EnzChek Phosphate Assay: Couples phosphate release to enzymatic reactions that produce a fluorescent product

    • Colorimetric assays based on phosphomolybdate reduction (e.g., with ascorbic acid)

  • Separation-based assays:

    • Thin-layer chromatography (TLC) to separate substrate and product

    • HPLC or LC-MS to quantify undecaprenyl pyrophosphate and undecaprenyl phosphate

    • Extraction methods that separate hydrophilic (phosphate) and hydrophobic (lipid) components

  • Radiometric assays:

    • Using 32P-labeled undecaprenyl pyrophosphate and measuring released 32P-phosphate

    • Scintillation counting after phase separation or TLC

  • Coupled enzyme assays:

    • Linking phosphate release to other enzymatic reactions that produce a measurable signal

    • Monitoring the formation of UndP-linked glycans as described in the multicomponent kinetic assay

For comprehensive kinetic characterization, the following parameters should be determined:

Table 2. Key Parameters for uppP Kinetic Characterization

ParameterDefinitionExperimental Approach
KmSubstrate concentration at half-maximal velocityVary substrate concentration, measure initial velocities
VmaxMaximum reaction velocityMeasure reaction rate at saturating substrate concentration
kcatTurnover number (catalytic constant)Calculate from Vmax and enzyme concentration
pH optimumpH at which enzyme activity is maximalMeasure activity across a pH range
Temperature optimumTemperature at which enzyme activity is maximalMeasure activity across a temperature range
Metal ion requirementsEffect of various metal ions on activityTest activity with different metal ions or chelators
Inhibition constantsKi values for various inhibitorsMeasure activity in presence of potential inhibitors

The optimized assay conditions should include appropriate controls, such as heat-inactivated enzyme, to ensure specificity of the measured activity. Time-course experiments should be performed to ensure measurements are made during the linear phase of the reaction.

How can structural studies of uppP inform inhibitor design?

Structural studies of C. jejuni uppP can provide critical insights that inform rational inhibitor design strategies. Although specific structural information about C. jejuni uppP is not provided in the search results, general approaches to structure-based inhibitor design can be outlined:

  • Structural determination methods:

    • X-ray crystallography remains the gold standard for high-resolution protein structures

    • Cryo-electron microscopy (cryo-EM) is particularly valuable for membrane proteins like uppP

    • NMR spectroscopy can provide dynamic information about protein-ligand interactions

    • Computational approaches including homology modeling based on related enzymes

  • Key structural insights for inhibitor design:

    • Active site architecture: Identification of the catalytic residues and substrate-binding pockets

    • Substrate binding mode: Understanding how undecaprenyl pyrophosphate interacts with the enzyme

    • Conformational changes: Identifying structural changes that occur during catalysis

    • Allosteric sites: Discovering potential binding sites distant from the active site that influence enzyme activity

  • Structure-based inhibitor design strategies:

    • Fragment-based approach: Identifying small molecular fragments that bind to different regions of the protein and linking them to create high-affinity inhibitors

    • Structure-based virtual screening: Using the protein structure to computationally screen large compound libraries

    • Rational design: Using knowledge of the substrate-binding mode to design competitive inhibitors

    • Transition state analogs: Designing molecules that mimic the transition state of the dephosphorylation reaction

Once inhibitor candidates are identified, co-crystallization or other structural studies with the inhibitor bound to uppP can provide detailed information about binding modes, allowing for further optimization of inhibitor properties.

The multicomponent kinetic assay described for the early enzymes in the C. jejuni N-linked glycosylation pathway could be adapted to screen potential inhibitors . This assay has been optimized with a Z'-factor of 0.77, indicating a robust assay suitable for screening compound libraries .

What model systems are most appropriate for studying uppP function in vivo?

Selecting appropriate model systems for studying uppP function in vivo requires consideration of both the biological relevance and technical feasibility. Several model systems can be employed:

  • Genetic manipulation in C. jejuni:

    • Gene knockout or knockdown approaches if uppP is not essential

    • Conditional expression systems for essential genes

    • Site-directed mutagenesis to create specific mutations in uppP

    • Reporter fusions to monitor expression and localization

  • Heterologous expression in model organisms:

    • E. coli with temperature-sensitive or deletable native uppP genes

    • Complementation studies to assess functional conservation

    • Expression of C. jejuni uppP in other bacterial species to study cross-species functionality

  • Cell culture infection models:

    • Human intestinal epithelial cell lines to study host-pathogen interactions

    • Macrophage cell lines to investigate immune responses

    • Organoid cultures derived from intestinal stem cells to better recapitulate the intestinal environment

  • Animal models of C. jejuni infection:

    • Avian models, as C. jejuni naturally colonizes the digestive tract of many bird species

    • Modified mouse models (germ-free or with humanized microbiota)

    • Ferret models that more closely mimic human campylobacteriosis

  • Biochemical and biophysical approaches:

    • Liposome reconstitution systems to study membrane protein function

    • In vitro glycosylation assays to monitor pathway activity

    • Purified enzyme systems to study specific reactions

Table 3. Comparison of Model Systems for Studying uppP Function

Model SystemAdvantagesLimitationsApplications
C. jejuni genetic manipulationMost relevant host contextTechnical challenges in genetic manipulationDirect assessment of uppP function
Heterologous expressionWell-established genetic toolsDifferent cellular environmentComplementation studies, protein production
Cell culture modelsHuman-relevant, controlled conditionsSimplified system compared to in vivoHost-pathogen interactions, cellular responses
Animal modelsComplex physiological contextSpecies differences, ethical considerationsColonization, pathogenesis studies
In vitro systemsPrecise biochemical control, simplicityLack of cellular contextMechanistic studies, inhibitor screening

The choice of model system should be guided by the specific research questions being addressed, with multiple complementary approaches often providing the most comprehensive understanding of uppP function in vivo.

How can pathway-based screening identify inhibitors of C. jejuni uppP?

Pathway-based screening offers a powerful approach to identify inhibitors of C. jejuni uppP within the context of its biological function in glycosylation pathways. The search results describe a multicomponent kinetic assay for the early enzymes in the C. jejuni N-linked glycosylation pathway that could be adapted for this purpose .

The described assay includes PglF, PglE, PglD, PglC, and PglA, which are involved in the biosynthesis of an undecaprenyl diphosphate-linked disaccharide . It monitors the transfer of [3H]GalNAc from the hydrophilic UDP-linked carrier to the lipophilic UndPP-diNAcBac (2,4-diacetamido-2,4,6-trideoxyglucose) . The optimized assay has a Z'-factor calculated to be 0.77, indicating it is robust and suitable for screening .

To adapt this assay for identifying uppP inhibitors, the following methodological approach could be employed:

  • Assay design:

    • Incorporate uppP into the multicomponent assay

    • Use undecaprenyl pyrophosphate as a substrate for uppP

    • Monitor the formation of glycosylated products that depend on uppP activity

    • Include appropriate controls to distinguish uppP inhibition from inhibition of other pathway enzymes

  • Screening strategy:

    • Primary screening of compound libraries using the high-throughput pathway assay

    • Secondary screening with a direct uppP activity assay to confirm target specificity

    • Counter-screening against human phosphatases to assess selectivity

    • Structure-activity relationship studies to optimize lead compounds

  • Validation methods:

    • Biochemical validation with purified recombinant uppP

    • Structural studies to confirm binding mode (if structural data is available)

    • Cellular assays to assess effects on C. jejuni glycosylation and growth

    • Infection models to evaluate impact on pathogenicity

The pathway-based approach offers several advantages:

  • It screens for inhibitors in a biologically relevant context

  • It can identify compounds that may not be detected in isolated enzyme assays

  • It provides immediate information about pathway specificity

  • It can reveal inhibitors with novel mechanisms of action

This approach is particularly valuable for identifying research tools to study C. jejuni glycosylation pathways, addressing the noted hindrance of "absence of small molecule inhibitors to reversibly control the process" . Additionally, such inhibitors could potentially serve as leads for the development of novel antimicrobial strategies targeting C. jejuni.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.