Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 UPF0126 membrane protein Cj0593c (Cj0593c)

Shipped with Ice Packs
In Stock

Description

Introduction to Campylobacter jejuni and the UPF0126 Protein Family

Campylobacter jejuni is a spiral-shaped gram-negative bacterium recognized as a leading cause of human food-borne gastrointestinal disease globally. The pathogenicity of C. jejuni is closely linked to its ability to invade intestinal epithelial cells, with this invasive capability being essential for causing illness . The bacterial membrane plays a crucial role in this pathogenic process, containing numerous proteins that facilitate adhesion, nutrient uptake, and interactions with host immune systems.

The UPF0126 family, to which Cj0593c belongs, represents a group of uncharacterized protein families with members distributed across various bacterial species. The "UPF" designation (Uncharacterized Protein Family) indicates that while these proteins have been identified through genomic analysis, their precise biological functions remain incompletely understood. As a membrane protein, Cj0593c likely plays a role in the complex membrane architecture of C. jejuni, potentially contributing to cellular processes that maintain membrane integrity or facilitate interactions with the external environment.

Gene and Protein Identification

Cj0593c is encoded by the cj0593c gene in the Campylobacter jejuni genome. The protein is formally identified by its UniProt accession number Q9PHS3 and is also known by the synonym "UPF0126 membrane protein Cj0593c" . The "c" suffix in the gene name typically indicates that the gene is encoded on the complementary DNA strand in the C. jejuni genome.

Expression System and Design

The recombinant form of Cj0593c is produced using Escherichia coli as the expression host. The construct includes the full-length protein (amino acids 1-210) fused to an N-terminal histidine tag (His-tag) . This design facilitates purification through affinity chromatography while preserving the native structure of the protein.

Purification and Quality Control

The His-tagged recombinant protein is purified to greater than 90% homogeneity as determined by SDS-PAGE analysis . This high level of purity is essential for research applications to ensure that experimental results can be attributed specifically to Cj0593c rather than contaminants.

Potential Functional Roles of Cj0593c in Campylobacter Biology

While the specific function of Cj0593c remains to be fully elucidated, its classification as a membrane protein suggests several potential roles in Campylobacter biology. Membrane proteins in C. jejuni are known to be involved in various essential functions, including:

Membrane Integrity and Biogenesis

The outer membrane of Gram-negative bacteria like C. jejuni is a key structure in maintaining cellular integrity and mediating interactions with the environment. Proper localization of membrane proteins requires specific chaperones to ferry them across the periplasm after they emerge from the Sec translocation system . While Cj0593c has not been specifically associated with this process, other membrane proteins in C. jejuni have been shown to play critical roles in maintaining membrane integrity.

Potential Role in Virulence

Several membrane proteins in C. jejuni are known to contribute to bacterial virulence. For instance, the Campylobacter invasion antigens (Cia) are secreted proteins required for maximal invasion of host epithelial cells . Although there is no direct evidence linking Cj0593c to virulence mechanisms, its membrane localization positions it as a potential contributor to host-pathogen interactions.

Studies of Membrane Protein Structure and Function

The availability of purified recombinant Cj0593c enables detailed structural and functional studies of this membrane protein. Techniques such as X-ray crystallography, nuclear magnetic resonance spectroscopy, or cryo-electron microscopy could potentially be employed to determine its three-dimensional structure, providing insights into its function.

Antibody Production and Immunological Studies

Recombinant Cj0593c can serve as an antigen for the production of specific antibodies. These antibodies could be valuable tools for:

  • Detecting and localizing Cj0593c in C. jejuni cells

  • Studying the expression patterns of Cj0593c under different conditions

  • Investigating potential interactions with host tissues

Comparative Studies with Other Bacterial Species

The UPF0126 protein family includes members from multiple bacterial species. Comparative studies using recombinant Cj0593c and its homologs from other bacteria could reveal conserved structural features and functions, potentially illuminating the biological significance of this protein family.

Functional Characterization

A primary direction for future research is the comprehensive functional characterization of Cj0593c. This could include:

  • Gene knockout studies to observe phenotypic changes

  • Interaction studies to identify binding partners

  • Expression analysis under various environmental conditions

Role in Campylobacter Pathogenesis

Investigating the potential role of Cj0593c in Campylobacter pathogenesis represents another important research avenue. Similar to studies conducted with other C. jejuni membrane proteins, researchers could examine whether Cj0593c contributes to adhesion, invasion, or resistance to host defense mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Cj0593c; UPF0126 membrane protein Cj0593c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Target Names
Cj0593c
Target Protein Sequence
MEINALTITTLYIIGISAEGMTGALAAGRHKMDLFGVIFIALVTAIGGGSIRDVLLGHYP LTWVKHPEYIILICFCALVATKIPRVVTKLETLFLTLDAIGLVVFSILGAQIAIDQNHGF IIAVAAAVITGVFGGILRDILCMRIPLVFQKEIYAGIAIIAGAIYYSLIIWLELNALVCT LLTLFIGVFARLLAIKYQWSLPIFSYNEEK
Uniprot No.

Target Background

Database Links

KEGG: cje:Cj0593c

STRING: 192222.Cj0593c

Protein Families
UPF0126 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of Cj0593c?

Cj0593c is a membrane protein from Campylobacter jejuni subsp. jejuni serotype O:2 with a full length of 210 amino acids. It belongs to the UPF0126 protein family, a group of membrane proteins with structures that have been characterized but whose functions remain largely unknown. Recombinant Cj0593c can be successfully expressed in E. coli expression systems with a histidine tag to facilitate purification and downstream analysis . The protein's membrane localization suggests potential roles in cellular processes that occur at the bacterial membrane interface, which may include nutrient transport, signaling, or maintaining membrane integrity.

How does Cj0593c expression change under different environmental conditions?

Gene expression studies have shown that Cj0593c is among the genes differentially expressed when C. jejuni is grown at various pH levels. Specifically, Cj0593c appears in cluster C of genes whose expression patterns change in response to acid stress conditions . This suggests that Cj0593c may play a role in the bacterial adaptive response to environmental pH changes. Understanding these expression patterns is crucial for researchers investigating bacterial survival mechanisms in different host environments or designing experiments that require specific expression conditions.

What methods are most effective for the recombinant expression of Cj0593c?

For effective recombinant expression of Cj0593c, the most successful approach has been demonstrated using E. coli BL21 as the host organism with the pET expression system, similar to methods used for other C. jejuni membrane proteins . The expression construct typically includes the Cj0593c gene sequence with codon optimization for expression in E. coli. Addition of a histidine tag facilitates purification using metal affinity chromatography. For membrane proteins like Cj0593c, expression conditions need careful optimization, including induction temperature (typically lower temperatures around 18-25°C), inducer concentration, and duration of expression to prevent the formation of inclusion bodies and ensure proper folding .

What purification strategies yield the highest purity of recombinant Cj0593c?

The most effective purification strategy for recombinant His-tagged Cj0593c involves a multi-step approach. Initial purification uses immobilized metal affinity chromatography (IMAC) with HisTrap columns, followed by proper refolding procedures if the protein is expressed in inclusion bodies . For membrane proteins like Cj0593c, extraction from the membrane fraction using appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) prior to purification is crucial. Subsequent purification steps may include size exclusion chromatography to remove aggregates and ion exchange chromatography for higher purity. Western blotting using anti-His antibodies can confirm the identity and purity of the recombinant protein . For proper refolding of membrane proteins, techniques such as linear decrease of the urea gradient on HisTrap columns have proven effective for other C. jejuni membrane proteins .

How might Cj0593c contribute to C. jejuni pathogenesis and host colonization?

While the exact role of Cj0593c in pathogenesis remains under investigation, its differential expression under acid stress conditions suggests potential involvement in adaptive responses that could affect colonization . C. jejuni encounters various pH environments during host colonization, including the acidic conditions of the stomach and the varying pH levels throughout the intestinal tract. Proteins that help the bacterium survive these changing conditions are critical for successful colonization. Research approaches to investigate this connection could include gene knockout studies followed by colonization assays in animal models (similar to those used for other C. jejuni proteins), acid survival assays comparing wild-type and Cj0593c mutant strains, and transcriptomic studies to identify co-regulated genes that might function in the same pathways .

What experimental approaches can reveal the function of Cj0593c given its current classification as a protein of unknown function?

Determining the function of Cj0593c requires a multi-faceted approach. First, computational analyses using advanced protein structure prediction tools (like AlphaFold) and homology modeling can provide initial functional hypotheses. Experimental verification should include gene knockout or CRISPR-Cas9 editing to create Cj0593c mutants, followed by comprehensive phenotypic characterization including growth curves under various conditions, metabolomics analysis, and virulence assays . Protein-protein interaction studies using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking followed by mass spectrometry can identify interaction partners, which may reveal functional pathways . Complementation studies, where the wild-type gene is reintroduced into a mutant strain, are essential to confirm that observed phenotypes are specifically due to the absence of Cj0593c and not polar effects on neighboring genes .

How does Cj0593c compare structurally and functionally to other membrane proteins in C. jejuni?

Comparative analysis between Cj0593c and well-characterized C. jejuni membrane proteins such as Omp18 and MOMP reveals important differences and similarities. Unlike MOMP, which has a known β-barrel structure with 18 β-strands and functions as a porin, the structural characteristics of Cj0593c remain less defined . While MOMP plays established roles in adhesion to host cells and antibiotic resistance, the functional role of Cj0593c appears more specialized, potentially in acid adaptation based on expression data . For structural studies, techniques successful with other C. jejuni membrane proteins should be applied, including X-ray crystallography or cryo-electron microscopy following purification in appropriate detergent micelles or nanodiscs. Functional comparisons can employ bacterial mutants with selective deletions in different membrane protein genes to identify unique versus overlapping phenotypes .

What role might Cj0593c play in C. jejuni adaptation during experimental evolution?

Experimental evolution studies with C. jejuni have shown significant adaptations to different environments, including changes in contingency loci and loss of functions required for in vivo growth when selective pressures are removed . As a membrane protein differentially expressed under varying pH conditions, Cj0593c may be subject to selective pressures during adaptation to new environments. To investigate this, researchers could design experimental evolution studies specifically tracking changes in Cj0593c sequence and expression during serial passage in media with different pH conditions or during host colonization. Whole genome sequencing of evolved populations could identify mutations in Cj0593c or associated regulatory elements. Additionally, comparing the fitness of Cj0593c mutants versus wild-type strains in competition assays would help determine if Cj0593c confers selective advantages under specific environmental conditions .

How can researchers develop specific antibodies against Cj0593c for immunological studies?

Developing specific antibodies against Cj0593c requires careful antigen design and validation. The process should begin with epitope prediction analyses to identify immunogenic regions of Cj0593c that are surface-exposed and unique to avoid cross-reactivity with other proteins. For polyclonal antibodies, purified recombinant Cj0593c can be used for immunization of rabbits or other suitable animals, following a standard immunization protocol with appropriate adjuvants . For monoclonal antibodies, additional steps include harvesting B cells from immunized mice, fusion with myeloma cells to create hybridomas, and screening for specific antibody production. Validation of antibody specificity should include western blotting against recombinant Cj0593c, wild-type C. jejuni lysates, and Cj0593c knockout mutant lysates as a negative control. Immunofluorescence microscopy can confirm the membrane localization of the protein and further validate antibody specificity .

What are the optimal conditions for assessing Cj0593c function in acid stress response experiments?

Based on gene expression data showing Cj0593c differential expression under various pH conditions, the optimal experimental design for assessing its role in acid stress response should include several key elements . Researchers should compare wild-type and Cj0593c mutant strains under a range of pH conditions (from pH 4.5 to 7.0, with 0.5 pH unit intervals) in both rich and minimal media to differentiate direct pH effects from nutrient availability factors. Time course experiments monitoring survival rates at different time points (15 minutes to 24 hours) are essential to distinguish between acute and adaptive responses. Complementation experiments, where the Cj0593c gene is reintroduced into the mutant strain, should confirm the phenotype is specifically due to Cj0593c loss. Molecular analyses should include RT-qPCR to monitor expression of Cj0593c and related genes, and proteomic analyses to identify changes in protein expression profiles between wild-type and mutant strains under acid stress .

How can researchers integrate Cj0593c into broader studies of C. jejuni membrane proteome?

Integrating Cj0593c into comprehensive membrane proteome studies requires sophisticated approaches. Researchers should employ complementary techniques including liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis of membrane fractions, specifically optimized for membrane proteins using appropriate detergents and digestion protocols . Cross-linking mass spectrometry (XL-MS) can capture protein-protein interactions within the membrane environment. Blue native PAGE followed by second-dimension SDS-PAGE can identify protein complexes containing Cj0593c. For functional studies, proximity-dependent biotin identification (BioID) or APEX2 proximity labeling with Cj0593c as the bait protein can identify neighboring proteins in the native membrane environment. Comparative proteomics between wild-type strains and Cj0593c mutants under various conditions (pH stress, oxygen limitation, bile salt exposure) can reveal condition-specific functions and interaction networks .

How can researchers overcome the challenges in crystallizing membrane proteins like Cj0593c?

Membrane protein crystallization presents significant challenges due to the hydrophobic nature of these proteins. For Cj0593c, researchers should consider several specialized approaches. Lipidic cubic phase (LCP) crystallization has proven successful for many membrane proteins and should be attempted with purified Cj0593c. Another approach is to create fusion constructs with crystallization chaperones such as T4 lysozyme or BRIL, which can provide additional hydrophilic surfaces for crystal contacts. Detergent screening is critical - starting with a panel of at least 10-12 different detergents (including maltosides, glucosides, and newer amphipols or nanodiscs) to identify conditions that maintain protein stability and homogeneity. Thermal stability assays using differential scanning fluorimetry can help identify optimal buffer conditions and ligands that stabilize the protein. If traditional crystallography proves challenging, researchers should consider alternative structural biology approaches such as cryo-electron microscopy, particularly if Cj0593c can be assembled into larger complexes or reconstituted into nanodiscs .

What strategies can address the potential toxicity of Cj0593c expression in heterologous systems?

Overexpression of membrane proteins often leads to toxicity in heterologous hosts. For Cj0593c, several strategies can mitigate this challenge. Using tightly controlled expression systems like the pET system with T7 lysozyme co-expression can reduce leaky expression. Lower incubation temperatures (16-20°C) during induction slow protein production and may allow proper membrane insertion. Specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3)) often show higher tolerance. Fusion tags such as MBP or SUMO not only facilitate solubility but can also reduce toxicity. For extreme cases, cell-free protein synthesis systems bypass toxicity issues completely. Codon optimization for the expression host is essential, as rare codons can lead to translational stalling and incomplete protein synthesis, which may contribute to toxicity. Finally, inducer concentration titration experiments are necessary to find the optimal balance between expression level and host viability .

How can researchers optimize conditions for studying Cj0593c interactions with other cellular components?

Studying protein-protein interactions involving membrane proteins requires specialized approaches. For Cj0593c, researchers should first ensure the protein is properly folded in an environment that mimics the native membrane. Detergent-solubilized Cj0593c may be reconstituted into proteoliposomes or nanodiscs to provide a more native-like environment. For identifying interaction partners, pull-down assays using His-tagged Cj0593c followed by mass spectrometry analysis can provide initial candidates . To validate these interactions, techniques such as microscale thermophoresis (MST) or bio-layer interferometry (BLI) offer advantages for membrane proteins as they require less material and are less sensitive to detergent presence than traditional methods. Bacterial two-hybrid systems specifically optimized for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid), can detect interactions in vivo. For structural studies of complexes, chemical cross-linking followed by mass spectrometry (XL-MS) can provide distance constraints between interacting regions. Finally, fluorescence resonance energy transfer (FRET) using fluorescently labeled Cj0593c and potential partners can monitor interactions in real-time and in living cells .

How might Cj0593c contribute to C. jejuni survival in host environments?

As a membrane protein differentially expressed under acid stress conditions, Cj0593c may contribute significantly to C. jejuni survival during host colonization . To investigate this role, researchers should conduct comparative survival assays using wild-type and Cj0593c knockout strains under conditions mimicking specific host environments: acidic pH (stomach), bile salts (small intestine), and varying oxygen concentrations (intestinal gradient). Transcriptomic analysis comparing gene expression between wild-type and Cj0593c mutants during exposure to these stressors could reveal regulatory networks involving Cj0593c. In vivo competition assays, where wild-type and tagged mutant strains co-infect animal models, can quantify the fitness contribution of Cj0593c during actual colonization. Immunofluorescence microscopy using anti-Cj0593c antibodies could track protein expression and localization changes during different phases of infection, potentially revealing spatiotemporal aspects of its function. These approaches would provide a comprehensive view of how Cj0593c may help C. jejuni adapt to and survive within the challenging and dynamic host environment .

What potential role could Cj0593c play in antibiotic resistance mechanisms?

While direct evidence linking Cj0593c to antibiotic resistance is not yet established, its membrane localization suggests potential involvement in resistance mechanisms. Researchers should investigate this by comparing minimum inhibitory concentrations (MICs) of various antibiotic classes between wild-type and Cj0593c mutant strains . Particular focus should be on antibiotics that target the cell envelope or must traverse the membrane to reach their targets. Membrane permeability assays using fluorescent dyes like propidium iodide or NPN (1-N-phenylnaphthylamine) could reveal whether Cj0593c affects the barrier function of the bacterial membrane. Antibiotic accumulation assays, measuring intracellular concentration of labeled antibiotics, would determine if Cj0593c influences drug uptake or efflux. For a more comprehensive approach, researchers could perform selection experiments subjecting both wild-type and Cj0593c mutant populations to increasing antibiotic concentrations, followed by genomic analysis to identify compensatory mutations in the absence of Cj0593c. This multi-faceted approach would establish whether Cj0593c contributes to intrinsic antibiotic resistance in C. jejuni and identify the underlying mechanisms .

How conserved is Cj0593c across Campylobacter species and strains?

Understanding the evolutionary conservation of Cj0593c requires comprehensive comparative genomics approaches. Researchers should perform sequence alignments of Cj0593c homologs across multiple Campylobacter species and strains, calculating percent identity and similarity scores. Phylogenetic analysis can reveal how Cj0593c has evolved relative to species divergence, identifying instances of accelerated evolution or purifying selection. Structural predictions for Cj0593c homologs can determine if structural features are more conserved than primary sequence, suggesting functional constraints. Synteny analysis examining the genomic context of Cj0593c across species can identify conserved gene neighborhoods that might indicate functional relationships. For a deeper understanding, selection analysis using methods like dN/dS ratios can identify specific amino acid positions under selective pressure. Additionally, examining the presence of Cj0593c in the core versus accessory genome across Campylobacter isolates would indicate whether it represents a fundamental or specialized function within the genus. This multifaceted approach would provide insights into the evolutionary importance of Cj0593c and guide functional predictions based on conservation patterns .

What experimental approaches can assess the specific contribution of Cj0593c to C. jejuni fitness during experimental evolution?

To specifically assess how Cj0593c contributes to bacterial fitness during adaptation to new environments, researchers should design experimental evolution studies that track changes in both Cj0593c sequence and expression levels . Parallel evolution experiments comparing wild-type strains and Cj0593c mutants subjected to the same selective pressures (such as fluctuating pH, antibiotic gradients, or host passage) would reveal environments where Cj0593c provides a fitness advantage. Time-course sampling and whole genome sequencing during the evolution experiments could identify compensatory mutations that arise specifically in Cj0593c mutants. Complementary transcriptomic and proteomic analyses at various time points would reveal how regulatory networks adapt to the absence of Cj0593c. For a more direct fitness measurement, barcoded strain competitions, where multiple genetically barcoded variants (with and without functional Cj0593c) compete in the same environment, followed by barcode sequencing to track population dynamics, would provide quantitative fitness coefficients. Finally, reconstructing observed mutations in ancestral backgrounds would confirm their adaptive value and establish causality between genetic changes and fitness effects .

How can Cj0593c be utilized in developing serological diagnostics for C. jejuni infections?

Developing serological diagnostics utilizing Cj0593c requires evaluation of its immunogenicity and specificity as a biomarker. Researchers should first assess antibody responses to purified recombinant Cj0593c in sera from confirmed C. jejuni infection cases compared to healthy controls and patients with other enteric infections . Western blotting, ELISA, and multiplexed bead-based assays can quantify these responses and determine sensitivity and specificity. To improve diagnostic performance, researchers might develop a panel combining Cj0593c with other immunogenic C. jejuni proteins like Omp18 and MOMP, which have shown promise in diagnostic applications . For point-of-care applications, lateral flow immunochromatographic assays using recombinant Cj0593c can be developed, similar to approaches used with other C. jejuni antigens. Validation studies should include diverse patient populations, different C. jejuni strain infections, and assessment of cross-reactivity with other Campylobacter species and common enteric pathogens. The timing of antibody responses to Cj0593c during infection should also be characterized to determine the optimal window for diagnostic testing .

What considerations are important when using Cj0593c as a target for vaccine development?

Using Cj0593c as a vaccine target requires careful evaluation of several factors. Researchers must first determine the surface accessibility of Cj0593c epitopes using computational prediction tools and experimental methods like surface biotinylation followed by mass spectrometry . Immunization studies in animal models should assess whether anti-Cj0593c antibodies are protective against challenge with diverse C. jejuni strains. Conservation analysis across clinical isolates is critical to ensure broad coverage against circulating strains. For subunit vaccine formulations, researchers should evaluate different expression systems (bacterial, yeast, baculovirus) for producing recombinant Cj0593c with native-like conformation and appropriate post-translational modifications. Adjuvant selection and delivery route optimization are essential for generating robust immune responses against membrane proteins, which can be less immunogenic than secreted antigens. Safety studies must assess potential molecular mimicry between Cj0593c epitopes and host proteins to mitigate autoimmunity risks, which is particularly important given the association between C. jejuni infection and Guillain-Barré syndrome. Finally, combination approaches incorporating Cj0593c with other protective antigens may enhance vaccine efficacy through synergistic immunity .

What bioinformatic pipelines are most effective for predicting Cj0593c structure-function relationships?

Predicting structure-function relationships for Cj0593c requires specialized bioinformatic approaches for membrane proteins. Researchers should implement a multi-stage pipeline beginning with transmembrane topology prediction using consensus approaches that combine multiple algorithms (TMHMM, MEMSAT, Phobius). Advanced protein structure prediction tools like AlphaFold2, especially with recent improvements for membrane proteins, can generate high-confidence structural models . These models should be refined through molecular dynamics simulations in explicit membrane environments to assess stability and identify conformational changes. Ligand binding site prediction tools specialized for membrane proteins can identify potential functional sites. Sequence-based approaches including evolutionary coupling analysis can detect co-evolving residues that likely form functional contacts. For functional annotation, researchers should use sensitive profile-based searches against specialized membrane protein databases and apply graph-based machine learning methods that propagate functional annotations through protein similarity networks. Finally, integrated approaches that combine structural predictions with experimental data from mutagenesis studies, cross-linking experiments, and evolutionary conservation can provide the most reliable structure-function predictions for this challenging class of proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.