Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 glycerol-3-phosphate acyltransferase (plsY) is a full-length enzyme (1–202 amino acids) encoded by the plsY gene (UniProt ID: A1VY78). This protein catalyzes the transfer of acyl groups to glycerol-3-phosphate, a critical step in phospholipid biosynthesis. It is expressed in E. coli with an N-terminal His tag for purification and research applications .
| Attribute | Details |
|---|---|
| Gene Name | plsY (CJJ81176_0381) |
| Synonyms | GPAT, LPA synthase, Acyl-PO4 G3P acyltransferase |
| Protein Length | Full-length (202 amino acids) |
| Tag | N-terminal His tag |
| Source Organism | C. jejuni subsp. jejuni serotype O:23/36 (strain 81-176) |
| Expression Host | E. coli |
| Purity | >90% (SDS-PAGE validated) |
The recombinant plsY protein has the following sequence:
MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIFNYDLEIHTHAPVFIIAF IIIYKHLPNIKRLIFKEECKVI .
plsY is essential for synthesizing lysophosphatidic acid (LPA), a precursor to phospholipids in bacterial membranes. Mutations in acyltransferases like plsY could alter membrane composition, impacting pathogen survival and host interactions .
Recombinant plsY is used in:
ELISA Kits: For detecting anti-C. jejuni antibodies in serum or purified samples .
Structural Studies: X-ray crystallography to elucidate enzyme-substrate interactions.
Vaccine Development: As a candidate antigen for serotype-specific immunological assays.
Creative Biomart. Recombinant Full Length Campylobacter Jejuni Subsp. Jejuni Serotype O:23/36 Glycerol-3-Phosphate Acyltransferase(plsY) Protein, His-Tagged. [Online]. [Accessed 2025-03-21].
Frontiers in Cellular and Infection Microbiology. Glycoconjugates Play a Key Role in Campylobacter jejuni Infection. [Online]. [Accessed 2025-03-21].
Afigen. ELISA Recombinant Campylobacter jejuni subsp. jejuni serotype O:23-36 Glycerol-3-phosphate acyltransferase(plsY). [Online]. [Accessed 2025-03-21].
mBio. Campylobacter jejuni Resistance to Human Milk Involves the Acyl-Phosphate Synthase AcpP. [Online]. [Accessed 2025-03-21].
Journal of Bacteriology. Genomic Diversity in Campylobacter jejuni: Identification of C. jejuni 81-176 Unique Genes. [Online]. [Accessed 2025-03-21].
Journal of Bacteriology. Identification of a Broad Family of Lipid A Late Acyltransferases with Specificity for Secondary Acylation. [Online]. [Accessed 2025-03-21].
PNAS. Comparative Phylogenomics of the Food-Borne Pathogen Campylobacter jejuni. [Online]. [Accessed 2025-03-21].
KEGG: cjj:CJJ81176_0381
STRING: 354242.Cjejjejuni_010100001915
Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter jejuni functions as a critical enzyme in phospholipid biosynthesis. The enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA), which is a precursor for membrane phospholipid synthesis . This reaction represents the first committed step in the biosynthesis of membrane phospholipids, making plsY essential for bacterial cell membrane integrity and function. In Campylobacter jejuni, which is a microaerophilic, gram-negative bacterium, membrane composition and integrity are particularly important for survival in various environmental conditions and during host colonization .
While plsY itself has not been directly identified as a virulence factor in Campylobacter jejuni, its essential role in membrane phospholipid biosynthesis indirectly contributes to pathogenesis through several mechanisms. As a key enzyme in phospholipid biosynthesis, plsY is critical for maintaining membrane integrity, which is essential for bacterial survival during host colonization and infection .
Campylobacter jejuni is one of the leading causes of bacterial foodborne disease worldwide, with its pathogenesis involving colonization of the intestinal tract, invasion of epithelial cells, and induction of inflammatory responses . The bacteria's ability to adapt to different host environments depends on functional membrane systems, for which plsY activity is crucial. Additionally, membrane phospholipids play important roles in the formation and function of outer membrane vesicles, which are involved in the delivery of virulence factors and modulation of host-pathogen interactions .
To effectively characterize the enzymatic activity of recombinant plsY in vitro, researchers should consider a multi-faceted approach:
Substrate specificity assay: Using radiolabeled or fluorescently labeled acyl-phosphate donors and glycerol-3-phosphate to measure the formation of lysophosphatidic acid. This can be analyzed via thin-layer chromatography or HPLC methods.
Kinetic analysis: Determining kinetic parameters (Km, Vmax, kcat) by varying substrate concentrations and measuring initial reaction rates. This provides insights into catalytic efficiency and potential regulatory mechanisms.
pH and temperature optima determination: Conducting activity assays across a range of pH values (5.0-9.0) and temperatures (25-45°C) to identify optimal conditions that reflect the microaerophilic nature of C. jejuni.
Inhibition studies: Testing various compounds for inhibitory effects on plsY activity, which could potentially identify novel antimicrobial targets.
Detergent effects: Since plsY is a membrane-associated enzyme, different detergents should be tested to optimize solubilization while maintaining enzymatic activity .
For accurate results, the recombinant protein should be properly folded and purified to >90% homogeneity as verified by SDS-PAGE . Activity measurements should incorporate appropriate controls, including heat-inactivated enzyme and no-substrate controls.
Genetic variation analysis of plsY across Campylobacter jejuni strains reveals potentially significant correlations with virulence potential, similar to what has been observed with other C. jejuni proteins like FspA . A comprehensive approach to investigating this correlation would include:
Comparative genomic analysis: Sequencing and alignment of plsY genes from multiple clinical and environmental isolates to identify polymorphisms and classify potential variants.
Structure-function correlation: Mapping identified polymorphisms to predicted functional domains of plsY to evaluate potential effects on enzymatic activity.
Expression level analysis: Quantitative RT-PCR and western blotting to determine if expression levels vary across strains with different virulence profiles.
Virulence model testing: Using recombinant plsY variants in cellular and animal models to assess differential effects on colonization, invasion, and inflammatory responses.
Research on other C. jejuni proteins has demonstrated that heterogeneity among bacterial strains can significantly affect virulence potential. For example, the flagellar secreted protein FspA exists in two distinct variants (FspA1 and FspA2), with only FspA2 inducing apoptosis in INT407 cells . A similar phenomenon might exist with plsY variants, potentially affecting membrane composition, stability under stress conditions, or interaction with host cells.
Glycerol-3-phosphate acyltransferase (plsY) likely plays a critical role in C. jejuni's adaptation to environmental stresses during infection through modulation of membrane phospholipid composition. The following mechanisms warrant investigation:
Temperature adaptation: During transition from environmental (lower) temperatures to host body temperature (37°C), membrane fluidity changes are essential. PlsY may alter the types of acyl chains incorporated into phospholipids in response to temperature shifts.
Acid stress resistance: In the stomach environment (pH 2-4), C. jejuni must maintain membrane integrity. PlsY activity could be modulated to incorporate specific fatty acids that contribute to acid resistance.
Oxygen tension adaptation: As a microaerophilic organism, C. jejuni must adapt to varying oxygen concentrations. Membrane composition adjustments mediated by plsY may contribute to survival under different oxygen conditions .
Bile salt resistance: In the intestinal environment, bacteria encounter bile salts that disrupt membranes. PlsY-mediated phospholipid modifications might enhance resistance to these detergent-like compounds.
Biofilm formation: PlsY activity may influence membrane properties that contribute to bacterial adhesion and biofilm development during colonization.
Experimental approaches to study these adaptations should include comparative membrane lipid profiling under different stress conditions, site-directed mutagenesis of plsY, and stress survival assays with wild-type versus plsY-modified strains.
The optimal expression and purification of recombinant Campylobacter jejuni plsY protein requires careful consideration of several parameters:
Expression system optimization:
Host selection: E. coli is the preferred expression host for recombinant plsY, though alternative systems including yeast, baculovirus, or mammalian cells can be considered for specific applications .
Vector design: Inclusion of an N-terminal His-tag facilitates purification while minimizing interference with enzyme activity. The pET vector system with T7 promoter typically yields good expression levels.
Induction conditions:
Temperature: Lower temperatures (16-25°C) during induction may improve protein folding
IPTG concentration: 0.1-0.5 mM, optimized empirically
Induction time: 4-16 hours
Purification protocol:
Cell lysis in Tris-based buffer (pH 8.0) containing appropriate detergents to solubilize membrane-associated proteins
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Size exclusion chromatography to remove aggregates
Optional ion-exchange chromatography for higher purity
Buffer composition for maximum stability:
Final storage buffer: Tris-based buffer with 50% glycerol, pH 8.0
Consider addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation
Aliquot and store at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles
The purified protein should achieve greater than 90% purity as determined by SDS-PAGE analysis . For working stocks, storage at 4°C for up to one week is recommended.
Designing effective inhibition studies targeting plsY for antimicrobial development requires a structured approach:
Target validation steps:
Confirm essentiality through conditional knockout or knockdown studies in C. jejuni
Establish robust enzymatic assays with Z' values >0.5 for high-throughput screening
Develop secondary cellular assays to confirm on-target effects in bacterial cells
Inhibitor screening strategy:
Virtual screening: Utilize structural models (homology-based if crystal structure unavailable) to identify potential binding sites and screen virtual compound libraries
Fragment-based approach: Screen fragment libraries and optimize hits through structure-guided design
Natural product screening: Test extracts from plants, fungi, or bacteria for inhibitory activity
Substrate analogs: Design and synthesize structural mimics of acyl-phosphate or glycerol-3-phosphate
Assay development considerations:
Primary biochemical assay: Measure production of lysophosphatidic acid using fluorescence-based detection
Counter-screening: Test against human GPAT enzymes to establish selectivity
Cellular assays: Determine MIC values against various C. jejuni strains
Resistance development: Monitor frequency of resistance emergence
Analysis of structure-activity relationships:
Create a table correlating inhibitor structural features with:
IC50 values against purified plsY
MIC values against C. jejuni
Selectivity indices (mammalian cell toxicity/bacterial MIC)
Physicochemical properties (solubility, stability)
Successful inhibitors should demonstrate potent activity against plsY (IC50 <1 μM), significant antibacterial activity against C. jejuni (MIC <8 μg/mL), and minimal toxicity to mammalian cells (selectivity index >10).
Investigating plsY's role in C. jejuni membrane biogenesis requires integration of genomic and proteomic approaches:
Genomic approaches:
Conditional gene expression systems: Implement tetracycline-responsive or riboswitch-based systems to control plsY expression levels and observe effects on growth and membrane formation
Site-directed mutagenesis: Generate point mutations in catalytic residues to create enzymatically compromised variants
Gene complementation studies: Complement plsY-deficient strains with wild-type or mutant variants to assess functional recovery
Transcriptomic analysis: Compare gene expression profiles between wild-type and plsY-depleted strains to identify compensatory pathways
Proteomic approaches:
Membrane proteome analysis: Compare membrane protein composition using quantitative proteomics (iTRAQ or TMT labeling) between normal and plsY-depleted conditions
Protein-protein interaction studies: Identify plsY interaction partners using techniques such as:
Pull-down assays with tagged recombinant plsY
Bacterial two-hybrid systems
Chemical crosslinking followed by mass spectrometry
Post-translational modification analysis: Examine whether plsY activity is regulated by modifications such as phosphorylation
Lipidomic integration:
Complement genomic and proteomic data with comprehensive lipidomic analysis to examine:
Changes in phospholipid species composition
Alterations in membrane lipid asymmetry
Effects on lipid raft formation
Data integration framework:
| Approach | Data Type | Expected Outcome | Integration Point |
|---|---|---|---|
| Genomics | Gene expression profiles | Identify compensatory pathways | Correlate with proteomic changes |
| Proteomics | Membrane protein abundance | Map membrane protein alterations | Link to lipid composition |
| Lipidomics | Lipid species profiles | Define membrane composition changes | Connect to phenotypic outcomes |
| Phenotypic | Growth, morphology, stress resistance | Characterize biological impacts | Validate molecular findings |
This multi-omics approach will provide a systems-level understanding of how plsY influences C. jejuni membrane biogenesis and identify potential vulnerabilities for therapeutic targeting.
Recombinant Campylobacter jejuni plsY protein presents several potential applications in vaccine development research:
As a vaccine candidate:
While not traditionally considered a primary vaccine antigen, plsY merits investigation due to:
Its essential role in bacterial membrane synthesis and potential surface exposure
High conservation across C. jejuni strains (unlike some surface antigens that show significant variation)
Limited homology to human proteins, potentially reducing autoimmunity risks
As a carrier protein for conjugate vaccines:
Recombinant plsY could serve as a carrier protein for conjugation with:
C. jejuni capsular polysaccharides
Lipooligosaccharide (LOS) components
Other poorly immunogenic epitopes from C. jejuni
Research approaches:
Immunogenicity assessment: Evaluate antibody responses to recombinant plsY in animal models
Adjuvant combinations: Test various adjuvant formulations to enhance immune responses
Epitope mapping: Identify immunodominant regions that might be incorporated into subunit vaccines
Cross-protection studies: Assess whether anti-plsY responses protect against diverse C. jejuni strains
Prior research on C. jejuni vaccines has explored various approaches including using truncated recombinant flagellin subunits . Similar strategies could be applied to plsY, potentially focusing on specific domains rather than the full-length protein. When designing such studies, researchers should carefully consider the appropriate animal models, as C. jejuni pathogenesis differs considerably between humans and common laboratory animals.
To comprehensively investigate plsY evolution across Campylobacter species, the following comparative genomic approaches would be most informative:
Sequence-based analyses:
Phylogenetic analysis: Construct maximum-likelihood trees based on plsY sequences from diverse Campylobacter species and strains to resolve evolutionary relationships
Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive, neutral, or purifying selection
Codon usage bias assessment: Analyze synonymous codon usage patterns to detect adaptation to specific hosts or environmental niches
Recombination detection: Apply methods such as RDP4 or ClonalFrameML to identify potential recombination events affecting plsY evolution
Genomic context analyses:
Synteny mapping: Compare gene arrangements surrounding plsY across species to identify conserved operonic structures or genomic rearrangements
Mobile genetic element screening: Identify potential insertion sequences, transposons, or prophages adjacent to plsY that might influence its evolution
Regulatory element prediction: Compare predicted promoters and other regulatory sequences to assess evolutionary changes in expression control
Functional divergence assessment:
Critical residue identification: Map conserved versus variable amino acids onto structural models to identify functionally important regions
Substrate specificity prediction: Analyze active site residues across species to predict potential differences in substrate preferences
Host adaptation signatures: Correlate plsY sequence variations with host range (avian, human, livestock) to identify potential host-specific adaptations
This multi-faceted approach would provide insights into how plsY has evolved within the Campylobacter genus, potentially revealing adaptations related to host specificity, environmental persistence, or pathogenic potential. The analysis should include sufficient sampling across the Campylobacter phylogenetic spectrum, including C. jejuni, C. coli, C. lari, C. fetus, and other relevant species .
Working with recombinant Campylobacter jejuni plsY presents several challenges due to its membrane-associated nature. The following table outlines common issues and recommended solutions:
When working with recombinant plsY, researchers should initially perform small-scale expression and purification trials to optimize conditions before scaling up. Additionally, characterizing the protein via multiple methods (circular dichroism, dynamic light scattering, thermal shift assays) can provide valuable information about stability and proper folding.
To accurately assess the impact of plsY mutations on C. jejuni membrane phospholipid composition, researchers should implement a comprehensive analytical strategy:
Genetic manipulation approaches:
Conditional expression systems: Rather than direct knockouts (which may be lethal), use inducible promoters to control plsY expression levels
Site-directed mutagenesis: Create point mutations in catalytic residues or substrate-binding domains
Domain swapping: Exchange domains between plsY variants from different strains to assess functional differences
Lipid extraction and analysis protocol:
Optimized extraction method: Use Bligh-Dyer or MTBE-based extraction protocols optimized for bacterial phospholipids
Multiple analytical platforms:
Liquid chromatography coupled to high-resolution mass spectrometry (LC-MS/MS)
Thin-layer chromatography (TLC) for broad class separation
31P-NMR spectroscopy for phospholipid class quantification
Targeted and untargeted approaches: Combine targeted analysis of known phospholipids with untargeted scanning to identify unexpected lipid species
Comprehensive data analysis:
Quantitative comparison of:
Major phospholipid classes (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin)
Fatty acid composition (chain length, saturation, branching)
Lysophospholipid abundance (as indicators of synthesis intermediates)
Statistical analysis: Apply multivariate statistical methods (PCA, PLS-DA) to identify significant changes
Temporal dynamics: Analyze samples at multiple time points to capture adaptive responses
Functional correlation:
Connect observed lipid changes to:
Membrane fluidity measurements using fluorescence anisotropy
Membrane permeability assessments
Antimicrobial peptide resistance
Stress survival characteristics
This integrated approach will provide both molecular detail on how plsY mutations affect phospholipid biosynthesis and broader insights into the physiological consequences of these changes for C. jejuni biology and pathogenesis.
The study of plsY in Campylobacter jejuni pathogenesis offers several promising research directions that may yield significant insights:
Host-pathogen interface studies: Investigating how plsY-dependent membrane composition affects interaction with host epithelial cells, particularly focusing on:
Adhesion to and invasion of intestinal epithelial cells
Resistance to host antimicrobial peptides
Evasion of innate immune recognition
Comparative virulence analysis: Developing isogenic strains with varying plsY activity levels or variant plsY alleles to assess differences in:
Colonization efficiency in animal models
Inflammatory response induction
Persistence under stress conditions
Systems biology approach: Integrating transcriptomic, proteomic, and lipidomic data to map how plsY-mediated changes in membrane composition ripple through cellular networks to affect virulence gene expression and stress responses.
Structure-function analysis: Resolving the three-dimensional structure of C. jejuni plsY to:
Identify potential species-specific features
Guide rational inhibitor design
Understand substrate specificity determinants
Environmental adaptation mechanisms: Examining how plsY activity modulates membrane composition to enable survival in diverse environments encountered during transmission from animal reservoirs to humans.
These research directions would significantly enhance our understanding of how this essential enzyme contributes to C. jejuni's remarkable success as a pathogen despite its relatively simple genomic makeup compared to other enteric pathogens . Furthermore, such studies may reveal novel interventions targeting membrane biogenesis as an alternative to conventional antibiotics, addressing the growing concern of antimicrobial resistance in Campylobacter species.
The study of Campylobacter jejuni plsY presents multiple avenues for developing novel antimicrobial strategies:
Direct enzymatic inhibition approaches:
Small molecule inhibitors: Development of specific plsY inhibitors through:
Structure-based design utilizing homology models or crystal structures
High-throughput screening of chemical libraries
Fragment-based drug discovery approaches
Peptidomimetic inhibitors: Design of peptides that mimic substrates or interaction partners but block catalytic activity
Membrane-targeting strategies:
Combination therapies: Pairing sub-inhibitory concentrations of plsY inhibitors with:
Membrane-active antimicrobial peptides
Agents that target other steps in phospholipid biosynthesis
Membrane permeabilizers: Developing compounds that exploit membrane composition changes in plsY-compromised bacteria
Genetic and immunological approaches:
Antisense technology: Oligonucleotides targeting plsY mRNA to reduce expression
CRISPR-based antimicrobials: Developing phage delivery systems carrying plsY-targeting CRISPR-Cas constructs
Vaccine development: Using knowledge of plsY's role to design better attenuated vaccine strains with controlled membrane alterations
Translational potential evaluation matrix:
| Approach | Development Complexity | Specificity | Resistance Risk | Delivery Challenges |
|---|---|---|---|---|
| Small molecule inhibitors | Moderate | High | Moderate | Low |
| Membrane-targeting combinations | Low | Moderate | Low | Low |
| Antisense/CRISPR approaches | High | Very high | Low | High |
| Vaccine applications | High | High | Very low | Moderate |