Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Campylobacter jejuni subsp. jejuni Serotype O:23/36 Glycerol-3-Phosphate Acyltransferase (plsY)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 glycerol-3-phosphate acyltransferase (plsY) is a full-length enzyme (1–202 amino acids) encoded by the plsY gene (UniProt ID: A1VY78). This protein catalyzes the transfer of acyl groups to glycerol-3-phosphate, a critical step in phospholipid biosynthesis. It is expressed in E. coli with an N-terminal His tag for purification and research applications .

Key Features

AttributeDetails
Gene NameplsY (CJJ81176_0381)
SynonymsGPAT, LPA synthase, Acyl-PO4 G3P acyltransferase
Protein LengthFull-length (202 amino acids)
TagN-terminal His tag
Source OrganismC. jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Expression HostE. coli
Purity>90% (SDS-PAGE validated)

Amino Acid Sequence

The recombinant plsY protein has the following sequence:
MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIFNYDLEIHTHAPVFIIAF IIIYKHLPNIKRLIFKEECKVI .

Role in Lipid Metabolism

plsY is essential for synthesizing lysophosphatidic acid (LPA), a precursor to phospholipids in bacterial membranes. Mutations in acyltransferases like plsY could alter membrane composition, impacting pathogen survival and host interactions .

Key Studies

Study FocusFindings
Membrane Structural ImpactAltered acylation patterns in C. jejuni mutants affect phage resistance and human milk tolerance .
Genomic DiversityStrain-specific variations in lipid biosynthesis genes (e.g., plsY) correlate with serotype differences (O:23/36 vs. O:2) .
Host AdaptationLipid A acylation modifications in C. jejuni reduce host immune recognition (e.g., TLR-4 activation) .

Detection and Assays

Recombinant plsY is used in:

  1. ELISA Kits: For detecting anti-C. jejuni antibodies in serum or purified samples .

  2. Structural Studies: X-ray crystallography to elucidate enzyme-substrate interactions.

  3. Vaccine Development: As a candidate antigen for serotype-specific immunological assays.

References

  1. Creative Biomart. Recombinant Full Length Campylobacter Jejuni Subsp. Jejuni Serotype O:23/36 Glycerol-3-Phosphate Acyltransferase(plsY) Protein, His-Tagged. [Online]. [Accessed 2025-03-21].

  2. Frontiers in Cellular and Infection Microbiology. Glycoconjugates Play a Key Role in Campylobacter jejuni Infection. [Online]. [Accessed 2025-03-21].

  3. Afigen. ELISA Recombinant Campylobacter jejuni subsp. jejuni serotype O:23-36 Glycerol-3-phosphate acyltransferase(plsY). [Online]. [Accessed 2025-03-21].

  4. mBio. Campylobacter jejuni Resistance to Human Milk Involves the Acyl-Phosphate Synthase AcpP. [Online]. [Accessed 2025-03-21].

  5. Journal of Bacteriology. Genomic Diversity in Campylobacter jejuni: Identification of C. jejuni 81-176 Unique Genes. [Online]. [Accessed 2025-03-21].

  6. Journal of Bacteriology. Identification of a Broad Family of Lipid A Late Acyltransferases with Specificity for Secondary Acylation. [Online]. [Accessed 2025-03-21].

  7. PNAS. Comparative Phylogenomics of the Food-Borne Pathogen Campylobacter jejuni. [Online]. [Accessed 2025-03-21].

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; CJJ81176_0381; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Target Names
plsY
Target Protein Sequence
MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIFNYDLEIHTHAPVFIIAF IIIYKHLPNIKRLIFKEECKVI
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter jejuni?

Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter jejuni functions as a critical enzyme in phospholipid biosynthesis. The enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA), which is a precursor for membrane phospholipid synthesis . This reaction represents the first committed step in the biosynthesis of membrane phospholipids, making plsY essential for bacterial cell membrane integrity and function. In Campylobacter jejuni, which is a microaerophilic, gram-negative bacterium, membrane composition and integrity are particularly important for survival in various environmental conditions and during host colonization .

How does Campylobacter jejuni plsY contribute to bacterial pathogenesis?

While plsY itself has not been directly identified as a virulence factor in Campylobacter jejuni, its essential role in membrane phospholipid biosynthesis indirectly contributes to pathogenesis through several mechanisms. As a key enzyme in phospholipid biosynthesis, plsY is critical for maintaining membrane integrity, which is essential for bacterial survival during host colonization and infection .

Campylobacter jejuni is one of the leading causes of bacterial foodborne disease worldwide, with its pathogenesis involving colonization of the intestinal tract, invasion of epithelial cells, and induction of inflammatory responses . The bacteria's ability to adapt to different host environments depends on functional membrane systems, for which plsY activity is crucial. Additionally, membrane phospholipids play important roles in the formation and function of outer membrane vesicles, which are involved in the delivery of virulence factors and modulation of host-pathogen interactions .

What experimental approaches are most effective for characterizing the enzymatic activity of recombinant plsY in vitro?

To effectively characterize the enzymatic activity of recombinant plsY in vitro, researchers should consider a multi-faceted approach:

  • Substrate specificity assay: Using radiolabeled or fluorescently labeled acyl-phosphate donors and glycerol-3-phosphate to measure the formation of lysophosphatidic acid. This can be analyzed via thin-layer chromatography or HPLC methods.

  • Kinetic analysis: Determining kinetic parameters (Km, Vmax, kcat) by varying substrate concentrations and measuring initial reaction rates. This provides insights into catalytic efficiency and potential regulatory mechanisms.

  • pH and temperature optima determination: Conducting activity assays across a range of pH values (5.0-9.0) and temperatures (25-45°C) to identify optimal conditions that reflect the microaerophilic nature of C. jejuni.

  • Inhibition studies: Testing various compounds for inhibitory effects on plsY activity, which could potentially identify novel antimicrobial targets.

  • Detergent effects: Since plsY is a membrane-associated enzyme, different detergents should be tested to optimize solubilization while maintaining enzymatic activity .

For accurate results, the recombinant protein should be properly folded and purified to >90% homogeneity as verified by SDS-PAGE . Activity measurements should incorporate appropriate controls, including heat-inactivated enzyme and no-substrate controls.

How does genetic variation in plsY across different Campylobacter jejuni strains correlate with virulence potential?

Genetic variation analysis of plsY across Campylobacter jejuni strains reveals potentially significant correlations with virulence potential, similar to what has been observed with other C. jejuni proteins like FspA . A comprehensive approach to investigating this correlation would include:

  • Comparative genomic analysis: Sequencing and alignment of plsY genes from multiple clinical and environmental isolates to identify polymorphisms and classify potential variants.

  • Structure-function correlation: Mapping identified polymorphisms to predicted functional domains of plsY to evaluate potential effects on enzymatic activity.

  • Expression level analysis: Quantitative RT-PCR and western blotting to determine if expression levels vary across strains with different virulence profiles.

  • Virulence model testing: Using recombinant plsY variants in cellular and animal models to assess differential effects on colonization, invasion, and inflammatory responses.

Research on other C. jejuni proteins has demonstrated that heterogeneity among bacterial strains can significantly affect virulence potential. For example, the flagellar secreted protein FspA exists in two distinct variants (FspA1 and FspA2), with only FspA2 inducing apoptosis in INT407 cells . A similar phenomenon might exist with plsY variants, potentially affecting membrane composition, stability under stress conditions, or interaction with host cells.

What role does plsY play in Campylobacter jejuni's adaptation to environmental stresses during infection?

Glycerol-3-phosphate acyltransferase (plsY) likely plays a critical role in C. jejuni's adaptation to environmental stresses during infection through modulation of membrane phospholipid composition. The following mechanisms warrant investigation:

  • Temperature adaptation: During transition from environmental (lower) temperatures to host body temperature (37°C), membrane fluidity changes are essential. PlsY may alter the types of acyl chains incorporated into phospholipids in response to temperature shifts.

  • Acid stress resistance: In the stomach environment (pH 2-4), C. jejuni must maintain membrane integrity. PlsY activity could be modulated to incorporate specific fatty acids that contribute to acid resistance.

  • Oxygen tension adaptation: As a microaerophilic organism, C. jejuni must adapt to varying oxygen concentrations. Membrane composition adjustments mediated by plsY may contribute to survival under different oxygen conditions .

  • Bile salt resistance: In the intestinal environment, bacteria encounter bile salts that disrupt membranes. PlsY-mediated phospholipid modifications might enhance resistance to these detergent-like compounds.

  • Biofilm formation: PlsY activity may influence membrane properties that contribute to bacterial adhesion and biofilm development during colonization.

Experimental approaches to study these adaptations should include comparative membrane lipid profiling under different stress conditions, site-directed mutagenesis of plsY, and stress survival assays with wild-type versus plsY-modified strains.

What are the optimal conditions for expressing and purifying recombinant Campylobacter jejuni plsY protein?

The optimal expression and purification of recombinant Campylobacter jejuni plsY protein requires careful consideration of several parameters:

Expression system optimization:

  • Host selection: E. coli is the preferred expression host for recombinant plsY, though alternative systems including yeast, baculovirus, or mammalian cells can be considered for specific applications .

  • Vector design: Inclusion of an N-terminal His-tag facilitates purification while minimizing interference with enzyme activity. The pET vector system with T7 promoter typically yields good expression levels.

  • Induction conditions:

    • Temperature: Lower temperatures (16-25°C) during induction may improve protein folding

    • IPTG concentration: 0.1-0.5 mM, optimized empirically

    • Induction time: 4-16 hours

Purification protocol:

  • Cell lysis in Tris-based buffer (pH 8.0) containing appropriate detergents to solubilize membrane-associated proteins

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates

  • Optional ion-exchange chromatography for higher purity

Buffer composition for maximum stability:

  • Final storage buffer: Tris-based buffer with 50% glycerol, pH 8.0

  • Consider addition of reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation

  • Aliquot and store at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles

The purified protein should achieve greater than 90% purity as determined by SDS-PAGE analysis . For working stocks, storage at 4°C for up to one week is recommended.

How can researchers effectively design inhibition studies targeting plsY for antimicrobial development?

Designing effective inhibition studies targeting plsY for antimicrobial development requires a structured approach:

Target validation steps:

  • Confirm essentiality through conditional knockout or knockdown studies in C. jejuni

  • Establish robust enzymatic assays with Z' values >0.5 for high-throughput screening

  • Develop secondary cellular assays to confirm on-target effects in bacterial cells

Inhibitor screening strategy:

  • Virtual screening: Utilize structural models (homology-based if crystal structure unavailable) to identify potential binding sites and screen virtual compound libraries

  • Fragment-based approach: Screen fragment libraries and optimize hits through structure-guided design

  • Natural product screening: Test extracts from plants, fungi, or bacteria for inhibitory activity

  • Substrate analogs: Design and synthesize structural mimics of acyl-phosphate or glycerol-3-phosphate

Assay development considerations:

  • Primary biochemical assay: Measure production of lysophosphatidic acid using fluorescence-based detection

  • Counter-screening: Test against human GPAT enzymes to establish selectivity

  • Cellular assays: Determine MIC values against various C. jejuni strains

  • Resistance development: Monitor frequency of resistance emergence

Analysis of structure-activity relationships:

  • Create a table correlating inhibitor structural features with:

    • IC50 values against purified plsY

    • MIC values against C. jejuni

    • Selectivity indices (mammalian cell toxicity/bacterial MIC)

    • Physicochemical properties (solubility, stability)

Successful inhibitors should demonstrate potent activity against plsY (IC50 <1 μM), significant antibacterial activity against C. jejuni (MIC <8 μg/mL), and minimal toxicity to mammalian cells (selectivity index >10).

What are the best approaches for studying the role of plsY in Campylobacter jejuni membrane biogenesis using genomic and proteomic methods?

Investigating plsY's role in C. jejuni membrane biogenesis requires integration of genomic and proteomic approaches:

Genomic approaches:

  • Conditional gene expression systems: Implement tetracycline-responsive or riboswitch-based systems to control plsY expression levels and observe effects on growth and membrane formation

  • Site-directed mutagenesis: Generate point mutations in catalytic residues to create enzymatically compromised variants

  • Gene complementation studies: Complement plsY-deficient strains with wild-type or mutant variants to assess functional recovery

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and plsY-depleted strains to identify compensatory pathways

Proteomic approaches:

  • Membrane proteome analysis: Compare membrane protein composition using quantitative proteomics (iTRAQ or TMT labeling) between normal and plsY-depleted conditions

  • Protein-protein interaction studies: Identify plsY interaction partners using techniques such as:

    • Pull-down assays with tagged recombinant plsY

    • Bacterial two-hybrid systems

    • Chemical crosslinking followed by mass spectrometry

  • Post-translational modification analysis: Examine whether plsY activity is regulated by modifications such as phosphorylation

Lipidomic integration:
Complement genomic and proteomic data with comprehensive lipidomic analysis to examine:

  • Changes in phospholipid species composition

  • Alterations in membrane lipid asymmetry

  • Effects on lipid raft formation

Data integration framework:

ApproachData TypeExpected OutcomeIntegration Point
GenomicsGene expression profilesIdentify compensatory pathwaysCorrelate with proteomic changes
ProteomicsMembrane protein abundanceMap membrane protein alterationsLink to lipid composition
LipidomicsLipid species profilesDefine membrane composition changesConnect to phenotypic outcomes
PhenotypicGrowth, morphology, stress resistanceCharacterize biological impactsValidate molecular findings

This multi-omics approach will provide a systems-level understanding of how plsY influences C. jejuni membrane biogenesis and identify potential vulnerabilities for therapeutic targeting.

How might recombinant plsY be utilized in Campylobacter jejuni vaccine development research?

Recombinant Campylobacter jejuni plsY protein presents several potential applications in vaccine development research:

As a vaccine candidate:
While not traditionally considered a primary vaccine antigen, plsY merits investigation due to:

  • Its essential role in bacterial membrane synthesis and potential surface exposure

  • High conservation across C. jejuni strains (unlike some surface antigens that show significant variation)

  • Limited homology to human proteins, potentially reducing autoimmunity risks

As a carrier protein for conjugate vaccines:
Recombinant plsY could serve as a carrier protein for conjugation with:

  • C. jejuni capsular polysaccharides

  • Lipooligosaccharide (LOS) components

  • Other poorly immunogenic epitopes from C. jejuni

Research approaches:

  • Immunogenicity assessment: Evaluate antibody responses to recombinant plsY in animal models

  • Adjuvant combinations: Test various adjuvant formulations to enhance immune responses

  • Epitope mapping: Identify immunodominant regions that might be incorporated into subunit vaccines

  • Cross-protection studies: Assess whether anti-plsY responses protect against diverse C. jejuni strains

Prior research on C. jejuni vaccines has explored various approaches including using truncated recombinant flagellin subunits . Similar strategies could be applied to plsY, potentially focusing on specific domains rather than the full-length protein. When designing such studies, researchers should carefully consider the appropriate animal models, as C. jejuni pathogenesis differs considerably between humans and common laboratory animals.

What comparative genomic approaches would be most informative for studying plsY evolution across Campylobacter species?

To comprehensively investigate plsY evolution across Campylobacter species, the following comparative genomic approaches would be most informative:

Sequence-based analyses:

  • Phylogenetic analysis: Construct maximum-likelihood trees based on plsY sequences from diverse Campylobacter species and strains to resolve evolutionary relationships

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive, neutral, or purifying selection

  • Codon usage bias assessment: Analyze synonymous codon usage patterns to detect adaptation to specific hosts or environmental niches

  • Recombination detection: Apply methods such as RDP4 or ClonalFrameML to identify potential recombination events affecting plsY evolution

Genomic context analyses:

  • Synteny mapping: Compare gene arrangements surrounding plsY across species to identify conserved operonic structures or genomic rearrangements

  • Mobile genetic element screening: Identify potential insertion sequences, transposons, or prophages adjacent to plsY that might influence its evolution

  • Regulatory element prediction: Compare predicted promoters and other regulatory sequences to assess evolutionary changes in expression control

Functional divergence assessment:

  • Critical residue identification: Map conserved versus variable amino acids onto structural models to identify functionally important regions

  • Substrate specificity prediction: Analyze active site residues across species to predict potential differences in substrate preferences

  • Host adaptation signatures: Correlate plsY sequence variations with host range (avian, human, livestock) to identify potential host-specific adaptations

This multi-faceted approach would provide insights into how plsY has evolved within the Campylobacter genus, potentially revealing adaptations related to host specificity, environmental persistence, or pathogenic potential. The analysis should include sufficient sampling across the Campylobacter phylogenetic spectrum, including C. jejuni, C. coli, C. lari, C. fetus, and other relevant species .

What are the common challenges in working with recombinant plsY and their solutions?

Working with recombinant Campylobacter jejuni plsY presents several challenges due to its membrane-associated nature. The following table outlines common issues and recommended solutions:

ChallengePotential CausesSolutions
Poor expression levelsToxicity to host cells
Codon bias issues
Protein misfolding
Use tightly controlled inducible systems
Utilize codon-optimized sequences
Express at lower temperatures (16-20°C)
Consider specialized expression strains (C41/C43)
Protein insolubilityHydrophobic transmembrane domains
Improper folding
Add appropriate detergents (DDM, CHAPS)
Use fusion partners (MBP, SUMO)
Optimize lysis buffer composition
Consider cell-free expression systems
Loss of activity during purificationDetergent effects on structure
Oxidation of critical residues
Cofactor loss
Screen multiple detergent types/concentrations
Add reducing agents (DTT, β-mercaptoethanol)
Supplement buffers with potential cofactors
Protein aggregation during storageConcentration effects
Buffer incompatibility
Freeze-thaw damage
Store at lower concentrations (0.1-1.0 mg/mL)
Add glycerol (20-50%)
Add stabilizing agents (trehalose, sucrose)
Aliquot to avoid repeated freeze-thaw cycles
Inconsistent activity assaysSubstrate quality
Enzyme stability
Detection sensitivity
Use freshly prepared or high-quality commercial substrates
Optimize assay temperature and pH
Develop more sensitive detection methods

When working with recombinant plsY, researchers should initially perform small-scale expression and purification trials to optimize conditions before scaling up. Additionally, characterizing the protein via multiple methods (circular dichroism, dynamic light scattering, thermal shift assays) can provide valuable information about stability and proper folding.

How can researchers accurately assess the impact of plsY mutations on Campylobacter jejuni membrane phospholipid composition?

To accurately assess the impact of plsY mutations on C. jejuni membrane phospholipid composition, researchers should implement a comprehensive analytical strategy:

Genetic manipulation approaches:

  • Conditional expression systems: Rather than direct knockouts (which may be lethal), use inducible promoters to control plsY expression levels

  • Site-directed mutagenesis: Create point mutations in catalytic residues or substrate-binding domains

  • Domain swapping: Exchange domains between plsY variants from different strains to assess functional differences

Lipid extraction and analysis protocol:

  • Optimized extraction method: Use Bligh-Dyer or MTBE-based extraction protocols optimized for bacterial phospholipids

  • Multiple analytical platforms:

    • Liquid chromatography coupled to high-resolution mass spectrometry (LC-MS/MS)

    • Thin-layer chromatography (TLC) for broad class separation

    • 31P-NMR spectroscopy for phospholipid class quantification

  • Targeted and untargeted approaches: Combine targeted analysis of known phospholipids with untargeted scanning to identify unexpected lipid species

Comprehensive data analysis:

  • Quantitative comparison of:

    • Major phospholipid classes (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin)

    • Fatty acid composition (chain length, saturation, branching)

    • Lysophospholipid abundance (as indicators of synthesis intermediates)

  • Statistical analysis: Apply multivariate statistical methods (PCA, PLS-DA) to identify significant changes

  • Temporal dynamics: Analyze samples at multiple time points to capture adaptive responses

Functional correlation:
Connect observed lipid changes to:

  • Membrane fluidity measurements using fluorescence anisotropy

  • Membrane permeability assessments

  • Antimicrobial peptide resistance

  • Stress survival characteristics

This integrated approach will provide both molecular detail on how plsY mutations affect phospholipid biosynthesis and broader insights into the physiological consequences of these changes for C. jejuni biology and pathogenesis.

What are the most promising research directions for understanding plsY's role in Campylobacter jejuni pathogenesis?

The study of plsY in Campylobacter jejuni pathogenesis offers several promising research directions that may yield significant insights:

  • Host-pathogen interface studies: Investigating how plsY-dependent membrane composition affects interaction with host epithelial cells, particularly focusing on:

    • Adhesion to and invasion of intestinal epithelial cells

    • Resistance to host antimicrobial peptides

    • Evasion of innate immune recognition

  • Comparative virulence analysis: Developing isogenic strains with varying plsY activity levels or variant plsY alleles to assess differences in:

    • Colonization efficiency in animal models

    • Inflammatory response induction

    • Persistence under stress conditions

  • Systems biology approach: Integrating transcriptomic, proteomic, and lipidomic data to map how plsY-mediated changes in membrane composition ripple through cellular networks to affect virulence gene expression and stress responses.

  • Structure-function analysis: Resolving the three-dimensional structure of C. jejuni plsY to:

    • Identify potential species-specific features

    • Guide rational inhibitor design

    • Understand substrate specificity determinants

  • Environmental adaptation mechanisms: Examining how plsY activity modulates membrane composition to enable survival in diverse environments encountered during transmission from animal reservoirs to humans.

These research directions would significantly enhance our understanding of how this essential enzyme contributes to C. jejuni's remarkable success as a pathogen despite its relatively simple genomic makeup compared to other enteric pathogens . Furthermore, such studies may reveal novel interventions targeting membrane biogenesis as an alternative to conventional antibiotics, addressing the growing concern of antimicrobial resistance in Campylobacter species.

How might the study of plsY contribute to novel antimicrobial strategies against Campylobacter jejuni?

The study of Campylobacter jejuni plsY presents multiple avenues for developing novel antimicrobial strategies:

Direct enzymatic inhibition approaches:

  • Small molecule inhibitors: Development of specific plsY inhibitors through:

    • Structure-based design utilizing homology models or crystal structures

    • High-throughput screening of chemical libraries

    • Fragment-based drug discovery approaches

  • Peptidomimetic inhibitors: Design of peptides that mimic substrates or interaction partners but block catalytic activity

Membrane-targeting strategies:

  • Combination therapies: Pairing sub-inhibitory concentrations of plsY inhibitors with:

    • Membrane-active antimicrobial peptides

    • Agents that target other steps in phospholipid biosynthesis

  • Membrane permeabilizers: Developing compounds that exploit membrane composition changes in plsY-compromised bacteria

Genetic and immunological approaches:

  • Antisense technology: Oligonucleotides targeting plsY mRNA to reduce expression

  • CRISPR-based antimicrobials: Developing phage delivery systems carrying plsY-targeting CRISPR-Cas constructs

  • Vaccine development: Using knowledge of plsY's role to design better attenuated vaccine strains with controlled membrane alterations

Translational potential evaluation matrix:

ApproachDevelopment ComplexitySpecificityResistance RiskDelivery Challenges
Small molecule inhibitorsModerateHighModerateLow
Membrane-targeting combinationsLowModerateLowLow
Antisense/CRISPR approachesHighVery highLowHigh
Vaccine applicationsHighHighVery lowModerate

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.