Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Lipoprotein signal peptidase (lspA) is a membrane-bound enzyme (EC 3.4.23.36) responsible for cleaving signal peptides from prolipoproteins in Gram-negative bacteria like C. jejuni. This post-translational modification is vital for:

  • Lipoprotein maturation: Enables proper localization and function of bacterial lipoproteins, many of which are virulence factors .

  • Pathogen survival: Facilitates membrane integrity and interactions with host cells .

In C. jejuni strain 81-176 (serotype O:23/36), lspA (UniProt ID: A1VY81) is encoded by the locus CJJ81176_0384 .

Mechanism of Action

  • Cleaves the signal peptide from prolipoproteins after the conserved "lipobox" sequence, enabling lipid anchoring to the membrane .

  • Essential for processing virulence-associated lipoproteins (e.g., JlpA, a surface-exposed adhesin) .

Role in Pathogenesis

  • Mutations in lspA disrupt lipoprotein processing, impairing bacterial adhesion, invasion, and immune evasion .

  • Lipoproteins processed by lspA contribute to antibiotic resistance and host inflammation .

Research Applications

Recombinant lspA is utilized in:

  • Vaccine development: As an antigen to elicit immune responses against C. jejuni .

  • Enzymatic assays: To study substrate specificity and inhibitor screening .

  • Structural studies: For crystallography or cryo-EM to resolve its mechanism .

Comparative Analysis with Related Proteins

ProteinGeneFunctionRole in Virulence
lspAlspASignal peptide cleavageEssential for lipoprotein maturation
JlpAjlpAAdhesion, glycosylationPromotes host cell binding
FlaAflaAFlagellar synthesisMotility and invasion

Technical Considerations

  • Purity: Optimized via affinity chromatography .

  • Stability: Sensitive to repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

  • Activity assays: Validated using synthetic lipobox-containing peptides .

Therapeutic Potential

  • Drug target: Inhibition of lspA could disrupt lipoprotein-dependent virulence mechanisms .

  • Challenges: High conservation across Campylobacter strains necessitates selective targeting to avoid off-effects .

Research Gaps and Future Directions

  • Structural dynamics: How lspA interacts with diverse lipoprotein substrates.

  • In vivo validation: Efficacy of lspA-based vaccines in animal models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for accurate delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are collected at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
lspA; CJJ81176_0384; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Target Names
lspA
Target Protein Sequence
MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGLRWQSEYLDLTYALNTGVAFSMLSFLEH NLKYLHLALIVVLFIYLFWQKTLLKTHSIAFGMMLGAGVSNLLDRFIHGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) in Campylobacter jejuni and what is its significance in bacterial physiology?

Lipoprotein signal peptidase (lspA) in C. jejuni is an essential membrane-bound enzyme that cleaves the signal peptide from prolipoproteins after lipid modification. Unlike many enteric pathogens that rely on common virulence factors, C. jejuni employs a unique collection of determinants for colonization and pathogenesis . The lspA enzyme plays a critical role in the maturation of bacterial lipoproteins, which are integral for membrane integrity, nutrient acquisition, adhesion, and immune evasion.

The significance of lspA lies in its contribution to C. jejuni's ability to establish persistent colonization in avian hosts while causing diarrheal disease in humans. Research indicates that properly processed lipoproteins are essential for the bacteria's survival in both environmental and host conditions, affecting its ability to withstand stress and adapt to different nutritional environments .

How does the structure of recombinant lspA from C. jejuni compare with lspA from other bacterial species?

While detailed structural studies specific to C. jejuni lspA are still emerging, comparative analysis with other bacterial species suggests conservation of the core catalytic mechanism but differences in substrate specificity that may relate to C. jejuni's specialized membrane composition. These differences potentially contribute to C. jejuni's unique colonization capabilities in diverse hosts and environmental niches.

What molecular techniques are most effective for identifying the lspA gene in different C. jejuni strains?

For effective identification of the lspA gene across C. jejuni strains, researchers typically employ:

  • PCR-based detection using primers targeting conserved regions of the lspA gene

  • Whole genome sequencing followed by bioinformatic analysis

  • Restriction fragment length polymorphism (RFLP) analysis

  • Quantitative real-time PCR for expression analysis

The significant intraspecies genotypic variation in C. jejuni necessitates careful primer design based on sequence alignments of multiple strains . For optimal results, researchers should consider techniques similar to those used in studies of other C. jejuni genes, such as those encoding adhesins, where strain-specific variations were successfully characterized using molecular approaches .

What expression systems yield the highest activity for recombinant C. jejuni lspA, and how do expression conditions affect protein functionality?

Recombinant C. jejuni proteins can be expressed in several systems, with E. coli being the most common, though yeast, baculovirus, and mammalian cell systems are also viable options . For membrane proteins like lspA, E. coli expression systems with modifications for membrane protein expression typically yield the best results.

Key considerations for optimal expression include:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, cost-effectivePotential improper foldingLower temperature (16-25°C), specific membrane-protein optimized strains (C41/C43)
YeastBetter for eukaryotic-like foldingLower yield than E. coli28-30°C, induction with methanol or galactose
BaculovirusSuperior folding for complex proteinsTime-consuming, expensive27°C, high-density insect cell culture
MammalianNative-like post-translational modificationsLowest yield, highest cost37°C, 5% CO₂, specialized media

The microaerobic growth requirements of C. jejuni proteins should be considered when optimizing expression conditions . Expression at lower temperatures (16-25°C) with slower induction rates often improves the folding and activity of membrane proteins like lspA. The choice between full-length protein expression versus truncated constructs (removing transmembrane domains) depends on the intended application, with full-length being challenging but necessary for functional studies.

What are the most effective purification strategies for obtaining high-purity recombinant C. jejuni lspA while maintaining enzymatic activity?

Purifying membrane proteins like lspA presents significant challenges due to their hydrophobic nature. Effective purification strategies include:

  • Detergent selection: Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin better preserve protein activity compared to harsher detergents like Triton X-100.

  • Affinity chromatography: Histidine-tagged constructs purified via nickel or cobalt affinity chromatography, followed by size exclusion chromatography for higher purity.

  • Protein stabilization: Addition of specific lipids during purification to maintain the native-like environment.

  • Activity preservation: Inclusion of glycerol (10-20%) and reducing agents in all buffers.

For C. jejuni membrane proteins, researchers have found that maintaining microaerobic conditions during cell lysis and initial purification steps can significantly improve yield and activity . Assessment of enzymatic activity at each purification stage is essential, as many membrane proteins lose functionality during the purification process.

How can researchers verify the correct folding and activity of recombinant lspA after purification?

Verifying correct folding and activity of recombinant lspA requires multiple complementary approaches:

  • Enzymatic activity assays: Using synthetic fluorogenic peptide substrates that mimic the cleavage site of natural prolipoproteins.

  • Circular dichroism (CD) spectroscopy: To assess secondary structure elements characteristic of properly folded lspA.

  • Thermal shift assays: To evaluate protein stability and potential ligand interactions.

  • Limited proteolysis: Properly folded proteins often show resistance to proteolytic digestion compared to misfolded variants.

  • Functional complementation: Demonstrating that the recombinant protein can restore function in lspA-deficient bacterial strains.

Given the importance of membrane integration for lspA function, researchers should consider reconstitution into liposomes or nanodiscs for activity assays, which better mimic the native membrane environment necessary for optimal enzymatic activity .

How does lspA contribute to C. jejuni adhesion to host cells, and what experimental models best demonstrate this relationship?

The contribution of lspA to C. jejuni adhesion occurs primarily through its role in processing adhesins and other membrane-associated virulence factors. Research indicates that properly processed bacterial lipoproteins facilitate attachment to host cell receptors and subsequent colonization .

Experimental models that effectively demonstrate this relationship include:

  • In vitro adhesion assays using LMH chicken hepatocellular carcinoma cells, which have shown differential binding abilities between C. jejuni strains, suggesting variation in adhesin processing and presentation .

  • Competition binding assays, where wild-type and lspA-mutant strains are compared for their ability to compete for binding sites on epithelial cells .

  • Immunofluorescence microscopy to visualize bacterial attachment patterns and quantify adhesion efficiency .

Studies have demonstrated that C. jejuni strains with properly functioning lipoprotein processing pathways show enhanced binding to epithelial cells compared to strains with defective processing . This suggests that lspA-processed lipoproteins play a crucial role in the initial stages of host colonization.

What is the role of lspA in C. jejuni flagellar assembly and motility, and how does this impact colonization potential?

The relationship between lspA and C. jejuni flagellar assembly is complex and multifaceted:

  • Lipoprotein signal peptidase processes several proteins involved in flagellar assembly and function.

  • Properly processed lipoproteins contribute to the structural integrity of the bacterial membrane, which indirectly supports flagellar motor function.

  • C. jejuni expresses multiple flagellar proteins that require proper membrane anchoring for effective motility .

The multiple roles of the flagellum in C. jejuni biology extend beyond simple motility to include secretion, adhesion, and invasion of host cells . Experimental evidence suggests that strains with defects in lipoprotein processing often show impaired flagellar function, reduced motility, and consequently decreased colonization potential in both avian and human hosts .

This relationship can be effectively studied using motility assays in soft agar, electron microscopy to visualize flagellar structures, and in vivo colonization models in chickens, which have revealed that flagellar motility is critical for C. jejuni to establish successful colonization .

How does lspA processing affect C. jejuni survival under different environmental stresses?

The processing of lipoproteins by lspA significantly impacts C. jejuni's ability to survive various environmental stresses:

Environmental StressImpact of lspA ProcessingExperimental Assessment Method
Oxidative stressProcessed lipoproteins protect against reactive oxygen speciesSensitivity to hydrogen peroxide, survival measurement
Temperature variationProper membrane integrity maintains stability at fluctuating temperaturesGrowth curves at different temperatures
Bile salt exposureProcessed membrane proteins contribute to bile resistanceMinimum inhibitory concentration (MIC) determinations
pH changesMembrane integrity affects proton permeabilitySurvival rates at varying pH levels
Nutrient limitationProperly processed nutrient transporters improve utilization of scarce resourcesGrowth in nutrient-restricted media

C. jejuni has strict growth and nutritional requirements compared to other enteric pathogens . Properly processed lipoproteins contribute to the bacteria's ability to survive these constraints by maintaining membrane integrity and function. Research indicates that strains with compromised lspA activity show increased susceptibility to environmental stresses, potentially explaining the reduced environmental persistence observed in certain C. jejuni mutants .

How do lspA-processed lipoproteins contribute to C. jejuni pathogenesis in human hosts versus commensalism in avian hosts?

The dual nature of C. jejuni as a human pathogen and avian commensal is partially attributed to differential lipoprotein processing and presentation in different host environments:

  • In human hosts, lspA-processed lipoproteins may trigger inflammatory responses through pattern recognition receptors, contributing to the characteristic inflammatory diarrhea .

  • In avian hosts, the same processed lipoproteins may interact differently with the immune system, facilitating persistent colonization without causing disease .

This host-specific difference has been demonstrated through competitive colonization studies in broiler chickens, where certain strains showed enhanced ability to establish commensalism . The differential response appears related to host-specific recognition of bacterial surface structures, many of which are lipoproteins processed by lspA.

Research suggests that C. jejuni adapts its lipoprotein expression and processing in response to host environmental cues, potentially explaining its success as both a pathogen and commensal organism .

What is the relationship between lspA function and antibiotic resistance in C. jejuni?

The relationship between lspA function and antibiotic resistance in C. jejuni involves several interconnected mechanisms:

  • Membrane integrity: Properly processed lipoproteins contribute to membrane structure, affecting permeability to antibiotics.

  • Efflux pump assembly: Several components of efflux systems require correct lipoprotein processing for optimal function.

  • Stress response: lspA-processed proteins contribute to general stress responses that indirectly enhance antibiotic tolerance.

Experimental approaches to study this relationship include:

  • Comparing minimum inhibitory concentrations (MICs) between wild-type strains and lspA mutants

  • Assessing expression of efflux pump components in response to antibiotic pressure

  • Evaluating membrane permeability changes in strains with altered lspA activity

Research using nalidixic acid-resistant and streptomycin-resistant C. jejuni strains has provided insights into how membrane protein modifications affect both colonization potential and antibiotic susceptibility profiles .

How does C. jejuni lspA processing influence interactions with other microbiota in the intestinal environment?

C. jejuni's interactions with intestinal microbiota are significantly influenced by its surface-exposed lipoproteins, many of which require lspA processing:

  • Competition for colonization niches: Studies have demonstrated that C. jejuni strains compete with each other for intestinal colonization, suggesting that processed adhesins mediate attachment to specific receptors .

  • Interspecies communication: C. jejuni-conditioned medium can increase flagellar expression and adhesion in non-invasive E. coli, indicating potential signaling mechanisms involving surface proteins .

  • Microbiota dysbiosis: During acute campylobacteriosis, C. jejuni may activate dormant virulence genes in other bacteria, potentially contributing to postinfectious intestinal disorders .

These interactions can be studied using co-culture experiments, competitive binding assays, and in vivo models of polymicrobial colonization. Research has shown that when different C. jejuni strains are introduced simultaneously, they compete for colonization in a dose-dependent manner, with higher doses of one strain reducing the colonization efficiency of another . This competition likely involves multiple factors, including properly processed adhesins and other surface proteins dependent on lspA function.

What are the most reliable methods for generating and validating lspA knockout mutants in C. jejuni?

Generating and validating lspA knockout mutants in C. jejuni requires specialized approaches due to the bacteria's unique genetic characteristics:

  • Allelic exchange mutagenesis: Using suicide vectors carrying disrupted lspA gene fragments flanked by homologous regions.

  • Insertional inactivation: Introducing antibiotic resistance cassettes into the lspA gene.

  • CRISPR-Cas9 based methods: For precise genome editing without antibiotic markers.

Validation of successful knockouts should include:

  • PCR verification of the modified genomic region

  • RT-PCR and/or Western blot analysis to confirm absence of lspA expression

  • Whole genome sequencing to verify no off-target modifications

  • Phenotypic assays to demonstrate expected changes in lipoprotein processing

  • Complementation studies to confirm that reintroduction of wild-type lspA restores function

When generating antibiotic-resistant strains for experimental purposes, researchers should confirm that the resistant mutants maintain native characteristics such as motility before use in downstream applications . This approach has been successfully used to create nalidixic acid-resistant and streptomycin-resistant C. jejuni strains for competitive colonization studies .

How can researchers effectively study substrate specificity of C. jejuni lspA?

Studying substrate specificity of C. jejuni lspA requires multiple complementary approaches:

  • Bioinformatic analysis:

    • Prediction of lipoprotein signal sequences using algorithms like LipoP

    • Comparative analysis of known lspA substrates across bacterial species

    • Structural modeling of enzyme-substrate interactions

  • Biochemical approaches:

    • In vitro cleavage assays using synthetic peptide substrates

    • Mass spectrometry to identify cleavage sites

    • Site-directed mutagenesis to modify substrate recognition sites

  • Cellular approaches:

    • Reporter fusion systems to monitor processing efficiency

    • Comparative proteomics of wild-type versus lspA-deficient strains

    • Pulse-chase experiments to track processing kinetics

Given C. jejuni's unique collection of factors for establishing colonization , its lspA may have evolved substrate preferences that differ from those in other bacterial species. Researchers should design experiments considering C. jejuni's specific growth requirements and cellular architecture to accurately characterize lspA substrate specificities.

What are the most effective approaches for studying lspA inhibition as a potential antimicrobial strategy?

Studying lspA inhibition as an antimicrobial strategy requires multifaceted approaches:

  • High-throughput screening:

    • Fluorescence-based assays using synthetic substrates

    • Cell-based reporter systems that indicate lipoprotein processing efficiency

    • Virtual screening using structural models of C. jejuni lspA

  • Structure-activity relationship studies:

    • Modification of known lspA inhibitors to improve specificity

    • Fragment-based drug discovery approaches

    • Rational design based on substrate binding pocket analysis

  • Efficacy evaluation:

    • Minimum inhibitory concentration (MIC) determination

    • Time-kill kinetics

    • Post-antibiotic effect measurements

    • Biofilm inhibition assays

  • In vivo validation:

    • Animal models of C. jejuni infection

    • Pharmacokinetic/pharmacodynamic studies

    • Resistance development assessment

Since C. jejuni has strict growth and nutritional requirements , inhibitor studies should include evaluation under conditions that mimic the bacteria's preferred microaerobic environment. Additionally, researchers should consider the potential for cross-inhibition of human enzymes and effects on beneficial microbiota when developing lspA inhibitors.

How does C. jejuni lspA differ from homologous enzymes in other enteric pathogens, and what are the functional implications of these differences?

C. jejuni lspA exhibits several distinctive features compared to homologous enzymes in other enteric pathogens:

FeatureC. jejuni lspAOther Enteric PathogensFunctional Implications
Sequence conservationModerate homology to E. coli lspAHigher conservation within EnterobacteriaceaePotential for C. jejuni-specific inhibitors
Substrate specificityMay recognize unique lipobox sequencesMore conserved recognition patternsProcessing of C. jejuni-specific virulence factors
Environmental sensitivityAdapted to microaerobic conditionsOften aerotolerantInfluence on colonization niches
Genetic contextUnique operon organizationOften conserved genetic neighborhoodsDifferential regulation during infection

While C. jejuni shares the fundamental type II signal peptidase mechanism with other bacteria, its unique ecological niche and host range have likely driven evolutionary adaptations in its lspA. Unlike many enteric pathogens that possess common virulence and colonization determinants, C. jejuni employs a different collection of factors , suggesting its lspA may process a distinct set of lipoproteins crucial for its specific pathogenic strategy.

These differences create opportunities for targeted antimicrobial development but also present challenges for extrapolating findings from model organisms to C. jejuni.

What evolutionary pressures have shaped the structure and function of lspA in C. jejuni serotype O:23/36?

The evolutionary trajectory of lspA in C. jejuni serotype O:23/36 has been shaped by multiple selective pressures:

  • Host adaptation pressures:

    • The need to colonize both avian and mammalian hosts

    • Selection for processing lipoproteins that facilitate commensalism in birds

    • Concurrent selection for virulence-associated lipoproteins in mammals

  • Environmental survival pressures:

    • Adaptation to microaerobic conditions

    • Response to temperature fluctuations during transmission

    • Resistance to host defense mechanisms

  • Genomic constraints:

    • Intraspecies genotypic variation in C. jejuni

    • Horizontal gene transfer events

    • Balance between conservation of essential function and adaptive variation

These evolutionary pressures have resulted in serotype-specific variations in lspA that likely contribute to the distinct colonization patterns and virulence potential of C. jejuni serotype O:23/36. Comparative genomic analyses of multiple C. jejuni strains have revealed significant variation in genes encoding surface-exposed proteins , suggesting that lspA has co-evolved with its substrates to maintain processing efficiency while accommodating strain-specific adaptations.

How do post-translational modifications of lipoproteins in C. jejuni compare with those in other bacterial species, and what role does lspA play in this process?

Post-translational modifications (PTMs) of lipoproteins in C. jejuni display several distinctive features compared to other bacterial species:

  • Lipid modifications:

    • C. jejuni appears to utilize the canonical bacterial lipoprotein processing pathway with potential modifications

    • The fatty acid composition of lipid anchors may differ due to C. jejuni's unique membrane composition

  • Glycosylation:

    • C. jejuni possesses both N-linked and O-linked glycosylation systems

    • Many lipoproteins undergo glycosylation after lspA processing

    • These glycosylation patterns may be critical for host-specific interactions

  • Sequential processing:

    • Following lspA cleavage, C. jejuni lipoproteins may undergo additional processing steps

    • These may include protease trimming, disulfide bond formation, and complex glycosylation

The role of lspA in this process is central but limited to the specific step of signal peptide cleavage after lipid modification. The efficiency and specificity of this cleavage can significantly impact downstream modifications by controlling the availability of correctly processed substrates for subsequent enzymes.

Understanding these unique aspects of C. jejuni lipoprotein processing could provide insights into the bacteria's distinctive colonization capabilities and host-specific pathogenesis mechanisms .

What are the key challenges in studying recombinant C. jejuni lspA, and how might these be addressed?

Researchers face several significant challenges when studying recombinant C. jejuni lspA:

  • Expression challenges:

    • Membrane protein expression issues including toxicity, misfolding, and aggregation

    • Microaerobic growth requirements of C. jejuni proteins

    • Solution: Specialized expression systems with tightly regulated induction and improved membrane protein folding capabilities

  • Functional assay limitations:

    • Difficulties in developing high-throughput assays for membrane-bound enzymatic activity

    • Limited availability of natural substrates

    • Solution: Development of fluorogenic reporter substrates and reconstitution systems in artificial membranes

  • Structural analysis hurdles:

    • Challenges in obtaining sufficient quantities of purified, active enzyme for structural studies

    • Crystallization difficulties common to membrane proteins

    • Solution: Alternative structural approaches like cryo-EM and NMR for membrane proteins

  • In vivo relevance validation:

    • Translating in vitro findings to the complex environment of the gastrointestinal tract

    • Accounting for host-specific differences in C. jejuni behavior

    • Solution: Development of improved animal models and organoid systems that better recapitulate host-specific environments

Addressing these challenges will require multidisciplinary approaches combining advanced molecular biology techniques, biophysical methods, and computational modeling to gradually build a comprehensive understanding of C. jejuni lspA function.

How might our understanding of C. jejuni lspA inform the development of novel antimicrobial strategies?

The potential for C. jejuni lspA as an antimicrobial target stems from several key considerations:

  • Essential function:

    • lspA is typically essential for bacterial viability

    • Inhibition could have bactericidal effects without equivalent host targets

  • Surface accessibility:

    • As a membrane protein, its active site may be accessible to inhibitors without requiring cellular penetration

    • Potential for development of compounds that specifically target C. jejuni

  • Pathogenesis relevance:

    • Inhibition would affect multiple virulence factors simultaneously

    • Could reduce colonization potential in both animal reservoirs and human hosts

  • Resistance considerations:

    • Target has low mutational flexibility due to essential function

    • Reduced likelihood of rapid resistance development

Future antimicrobial development could focus on:

  • Peptidomimetic inhibitors based on natural substrates

  • Structure-based design of specific C. jejuni lspA inhibitors

  • Combination strategies targeting both lspA and other essential processes

  • Development of narrow-spectrum agents that specifically target C. jejuni without disrupting beneficial microbiota

These approaches could help address the need for targeted antimicrobial strategies against C. jejuni, which remains a significant cause of bacterial diarrheal disease worldwide .

What are the most promising directions for future research on recombinant C. jejuni lspA?

Future research on recombinant C. jejuni lspA should focus on several promising directions:

  • Structural biology:

    • High-resolution structural determination of C. jejuni lspA

    • Structural comparison with homologs from other bacterial species

    • Substrate-bound structures to elucidate specificity determinants

  • Systems biology approaches:

    • Global lipoprotein processing networks in C. jejuni

    • Transcriptional regulation of lspA in response to environmental changes

    • Integration of lspA function with other post-translational modification systems

  • Host-pathogen interaction studies:

    • Role of lspA-processed lipoproteins in modulating host immune responses

    • Differential processing in avian versus mammalian hosts

    • Contribution to post-infectious complications like inflammatory bowel disease and irritable bowel syndrome

  • Applied research:

    • Development of high-throughput screening systems for lspA inhibitors

    • Engineering recombinant C. jejuni strains with modified lspA activity for vaccine development

    • Exploring lspA as a potential diagnostic marker for specific C. jejuni strains

These research directions would build upon our current understanding of C. jejuni as a unique pathogen with specialized adaptation mechanisms and could lead to breakthroughs in controlling this significant cause of bacterial gastroenteritis worldwide.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.