Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; CJJ81176_0431; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Target Names
lgt
Target Protein Sequence
MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVKKFQLDINEKHLDSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGILRH PSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Prolipoprotein diacylglyceryl transferase (lgt) in Campylobacter jejuni?

Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the first and critical step in bacterial lipoprotein biogenesis. In Campylobacter jejuni, as in other Gram-negative bacteria, lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox of prolipoproteins. This post-translational modification is essential for proper localization and function of lipoproteins, which play crucial roles in bacterial growth, outer membrane integrity, nutrient uptake, and pathogenesis . The significance of lgt in C. jejuni is underscored by the fact that deletion of the lgt gene is often lethal to Gram-negative bacteria, making it a potential antibacterial target .

What expression systems are most effective for producing recombinant C. jejuni lgt?

Recombinant C. jejuni lgt can be expressed using several heterologous systems, each with distinct advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, rapid growth, well-established protocolsMay require codon optimization, potential issues with membrane protein folding
YeastPost-translational modifications, eukaryotic machineryLonger expression time, different membrane composition
BaculovirusHigh-level expression, suitable for complex proteinsMore complex setup, longer production time
Mammalian CellNative-like folding environmentLower yields, expensive, time-consuming

For most research applications, E. coli remains the preferred host for recombinant expression of C. jejuni lgt, as it provides sufficient yields of functional protein for biochemical and structural studies . When expressing in E. coli, strains optimized for membrane protein expression such as C41(DE3) or C43(DE3) often yield better results than standard BL21(DE3) strains .

How do you confirm the enzymatic activity of recombinant C. jejuni lgt?

The enzymatic activity of recombinant C. jejuni lgt can be confirmed through multiple complementary approaches:

  • In vitro biochemical assay: Measuring the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate derived from a lipoprotein (such as Pal-IAAC, where C is the conserved cysteine). The reaction can be monitored by detecting glycerol phosphate release using a coupled enzymatic assay with luciferase .

  • Complementation assay: Testing whether the recombinant C. jejuni lgt can rescue growth in an E. coli lgt conditional knockout strain. Successful complementation indicates functional activity of the recombinant enzyme .

  • Mass spectrometry: Analyzing lipid modifications of substrate peptides after incubation with the purified enzyme to directly detect the addition of diacylglyceryl moieties .

  • GFP-based in vitro assay: Using GFP-fused substrate peptides to monitor changes in lipidation status, which can be correlated with the activity of lgt .

What structural features distinguish C. jejuni lgt from its E. coli ortholog?

While the crystal structure of C. jejuni lgt has not been specifically reported in the provided search results, comparative analysis can be made based on the E. coli lgt structure and sequence homology. Key structural features of lgt enzymes include:

  • Transmembrane domains: E. coli lgt contains multiple transmembrane helices that anchor it in the inner membrane. C. jejuni lgt likely has a similar membrane topology but may show differences in the arrangement of these helices.

  • Active site residues: The catalytic site of E. coli lgt includes critical residues such as Arg143 and Arg239 that are essential for diacylglyceryl transfer . The conservation of these residues in C. jejuni lgt should be analyzed to understand potential functional differences.

  • Substrate binding sites: E. coli lgt has two binding sites - one for phosphatidylglycerol and another for the lipobox-containing peptide. The architecture of these binding pockets in C. jejuni lgt may differ, potentially affecting substrate specificity.

  • Lateral access channels: In E. coli lgt, substrates enter and products exit laterally relative to the lipid bilayer . The geometry of these channels in C. jejuni lgt may be adapted to its native membrane environment.

Sequence alignment and homology modeling would be required to fully characterize these differences between C. jejuni and E. coli lgt proteins.

What detergents are most effective for solubilization and purification of recombinant C. jejuni lgt?

The choice of detergent is critical for maintaining the stability and activity of membrane proteins like lgt during solubilization and purification. Based on successful approaches with related membrane proteins , recommended detergents include:

DetergentAdvantagesApplications
DDM (n-Dodecyl β-D-maltoside)Mild, preserves protein activityGeneral solubilization, purification
LDAO (Lauryldimethylamine oxide)Effective for crystallizationLater purification stages, crystallization
OG (n-Octyl-β-D-glucoside)Small micelle sizeCrystallization trials
C8E4 (Octyltetraoxyethylene)Works well with β-barrel proteinsFinal purification steps
CHAPSOForms bicelles with lipidsNMR studies, stabilizing protein complexes

For initial solubilization, DDM at 1-2% concentration is often the safest starting point, with potential transition to other detergents during later purification steps . The final choice should be validated experimentally for C. jejuni lgt by assessing protein stability, homogeneity, and enzymatic activity in each detergent.

How does the lateral gene transfer (LGT) history of C. jejuni impact the analysis of lgt gene sequences from different strains?

Lateral gene transfer (LGT) significantly influences the genomic diversity of Campylobacter jejuni populations and must be considered when analyzing lgt sequences from different strains:

  • Sequence variation: LGT events can introduce novel allelic variants of lgt, potentially leading to different functional properties or substrate specificities. Studies have identified >100,000 putative high-confidence LGT events in human microbiome bacteria (~2 per assembled microbial genome) .

  • Phylogenetic discordance: When constructing phylogenetic trees based on lgt sequences, incongruence with species trees might indicate historical LGT events. Methods such as WAAFLE can be used to identify such discordances in metagenomic data .

  • Selective pressures: LGT events may be more frequent in genes under specific selective pressures. The essential nature of lgt may lead to different patterns of conservation compared to accessory genes .

  • Strain-specific adaptation: Different C. jejuni strains (such as serotype O:23/36) may have acquired lgt variants adapted to their specific ecological niches or host environments .

To properly account for LGT when analyzing lgt sequences, researchers should employ methods that detect individual LGT events (such as phylogenetic incongruence) and estimate homologous recombination rates .

What are the molecular mechanisms of resistance to lgt inhibitors in C. jejuni, and how do they differ from those in E. coli?

The molecular mechanisms of resistance to lgt inhibitors in C. jejuni have not been extensively characterized, but insights can be drawn from studies on E. coli lgt inhibition:

Research approaches to investigate these mechanisms should include directed evolution experiments, comparative genomics of resistant strains, and biochemical characterization of inhibitor binding to wild-type and mutant lgt proteins.

How can site-directed mutagenesis of C. jejuni lgt inform the design of species-specific inhibitors?

Site-directed mutagenesis of C. jejuni lgt can provide critical insights for the rational design of species-specific inhibitors through several strategic approaches:

  • Active site mapping: By systematically mutating predicted catalytic residues (based on homology to E. coli lgt where residues like Arg143 and Arg239 are essential ), researchers can identify the precise amino acids required for C. jejuni lgt activity. Residues that are conserved in C. jejuni but differ in human cells represent optimal targets for inhibitor design.

  • Substrate specificity determinants: Mutations in the substrate binding pockets can reveal which residues interact with phosphatidylglycerol versus the lipobox-containing peptide. Differences in these regions between C. jejuni and other bacterial species may be exploited for selective inhibition.

  • Allosteric site identification: Mutations in regions distant from the active site that affect enzyme activity may reveal allosteric regulatory sites that could serve as alternative binding sites for inhibitors.

  • Species-specific structural elements: Targeting unique structural features of C. jejuni lgt that are absent in beneficial gut bacteria could lead to narrower-spectrum inhibitors with fewer side effects.

Experimental design should include:

  • Expression of mutant proteins in an E. coli lgt-knockout complementation system

  • In vitro enzymatic assays to measure kinetic parameters (Km, kcat) of mutant enzymes

  • Thermal shift assays to assess structural stability of mutants

  • Inhibitor binding studies with various candidate compounds

  • Crystallography of mutant proteins in complex with inhibitors (if feasible)

What is the impact of environmental adaptation on the functional evolution of lgt in C. jejuni during laboratory passage versus host colonization?

The functional evolution of lgt in C. jejuni under different selective pressures reveals fundamental aspects of bacterial adaptation:

In laboratory passage:
C. jejuni exhibits rapid adaptation to laboratory conditions that differs markedly from pressures in the host environment. During in vitro experimental evolution, C. jejuni undergoes significant genomic changes:

  • Loss of virulence factors: Serial passage in rich medium results in the loss of flagellar motility (essential for host colonization) and mutations in virulence-related loci . Similar changes might affect membrane proteins and potentially lgt function or regulation.

  • Genomic instability: C. jejuni demonstrates high rates of mutation during laboratory evolution, including transitions, transversions, and slip-strand mutations . These could affect the lgt gene or its regulatory elements.

  • Genome reduction: Adaptation to laboratory conditions leads to genome reduction in C. jejuni , potentially affecting accessory functions while maintaining essential genes like lgt.

During host colonization:
When subjected to host environmental pressures, C. jejuni maintains systems critical for survival in the host:

  • Phase variation: In the host environment, C. jejuni undergoes phase variation in contingency loci with homopolymeric tracts , which may affect the expression of genes interacting with lgt or lipoprotein processing.

  • Conservation of essential functions: The lgt gene is likely to remain under strong purifying selection in the host environment due to its essential role in outer membrane integrity and pathogenesis.

  • Host-specific adaptation: Different host environments may select for subtle variations in lgt function or regulation to optimize lipoprotein processing under specific conditions.

Comparative analysis methodology:
To study these differences, researchers should:

  • Sequence lgt genes from C. jejuni populations before and after laboratory passage

  • Perform parallel evolution experiments in both laboratory media and animal models

  • Quantify selection pressures on lgt using dN/dS ratios

  • Assess functional changes in recombinant lgt proteins from evolved populations

  • Examine epistatic interactions between lgt and other genes in the lipoprotein biosynthesis pathway

What are the optimal purification and crystallization conditions for structural studies of C. jejuni lgt that would facilitate structure-based drug design?

Successful structural studies of C. jejuni lgt would provide invaluable information for structure-based drug design. Based on successful approaches with related membrane proteins and E. coli lgt , the following conditions are recommended:

Purification Protocol:

  • Expression system:

    • Host: C43(DE3) E. coli strain (optimized for membrane protein expression)

    • Vector: pET-based with C-terminal His6-tag or Strep-tag

    • Induction: 0.1-0.5 mM IPTG at 18-20°C for 16-20 hours

  • Membrane preparation:

    • Cell disruption by sonication or microfluidizer

    • Membrane isolation by ultracentrifugation (100,000×g, 1 hour)

  • Solubilization:

    • Initial solubilization with 1% DDM in buffer containing 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 5 mM β-mercaptoethanol

    • Alternative detergents to screen: LDAO, OG, DM, Cymal-6

  • Purification steps:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA

    • Size exclusion chromatography using Superdex 200

    • Optional: Ion exchange chromatography for additional purity

  • Detergent exchange:

    • During final purification steps, test exchanges to detergents more suitable for crystallization: LDAO, OG, NG, or C8E4

Crystallization Approaches:

MethodAdvantagesSpecial Considerations
Vapor diffusionStandard approach, well-establishedScreen with various detergents (DDM, LDAO, OG)
Lipidic cubic phaseBetter for membrane proteinsRequires special setup, monoolein as host lipid
BicellesMaintains native-like environmentCHAPSO/DMPC mixtures at specific ratios
In mesoHigh success with membrane proteinsComplex setup, specialized equipment

Critical Parameters:

  • Protein concentration: 5-15 mg/mL

  • Temperature: Screen at 4°C and 20°C

  • Additives to screen:

    • Substrate analogs (phosphatidylglycerol)

    • Divalent cations (Mg2+, Ca2+)

    • Potential inhibitors (palmitic acid derivatives)

    • Lipid additives (E. coli polar lipids)

  • Crystal evaluation:

    • X-ray diffraction screening at synchrotron sources

    • Target resolution: <2.5 Å for drug design purposes

The crystallization of C. jejuni lgt will likely require extensive screening (1000+ conditions) and optimization, with careful attention to protein stability and homogeneity throughout the process .

What is the most effective cloning strategy for expressing recombinant C. jejuni lgt for functional studies?

The following comprehensive cloning and expression strategy is optimized for recombinant C. jejuni lgt production:

Gene Source and Optimization:

  • Template selection:

    • Use genomic DNA from C. jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

    • Alternative source: Synthetic gene with optimized codon usage for expression host

  • Sequence optimization considerations:

    • Codon optimization for E. coli (if using E. coli as expression host)

    • Removal of rare codons and secondary structure in mRNA

    • Preservation of critical features (transmembrane domains, active site)

Vector Selection:

Vector TypeAdvantagesBest Applications
pET vectors (pET28a)T7 promoter, high expressionInitial expression screening
pBAD vectorsTight regulation, arabinose inductionToxic protein expression
pWaldo-GFPdGFP fusion for folding assessmentOptimization of expression conditions
pASK-IBATetracycline induction, precise controlFine-tuning expression levels

Fusion Tag Strategy:

  • C-terminal His6-tag: Minimal interference with membrane insertion, effective for IMAC purification

  • Alternative tags to consider:

    • Strep-tag II: Gentler elution conditions

    • GFP fusion: Monitoring of expression and folding

    • SUMO or MBP: Potential solubility enhancement

  • Cleavage sites:

    • Include TEV or PreScission protease sites for tag removal

    • Position cleavage site to avoid disrupting membrane topology

Expression Protocol:

  • Host strain selection:

    • Primary recommendation: C43(DE3) - derived from BL21(DE3), optimized for membrane proteins

    • Alternative strains: Lemo21(DE3), Rosetta(DE3), BL21(DE3) pLysS

  • Culture conditions:

    • Medium: Terrific Broth supplemented with 0.5% glucose

    • Temperature: Induction at 18-20°C

    • Induction: 0.1-0.5 mM IPTG or 0.02% arabinose (depending on vector)

    • Duration: 16-20 hours post-induction

  • Scale-up strategy:

    • Initial screening in 10 mL cultures

    • Optimization in 50-100 mL cultures

    • Production in 2-10 L cultures

This strategy integrates the advantages of various expression systems while addressing the specific challenges of membrane protein expression, allowing for efficient production of functional C. jejuni lgt for subsequent studies .

How do you design a high-throughput screening assay for identifying inhibitors of C. jejuni lgt?

A comprehensive high-throughput screening (HTS) assay for C. jejuni lgt inhibitors can be designed using the following methodological approach:

Primary Biochemical Assay:

  • Assay principle:

    • Monitor the release of glycerol phosphate (G1P/G3P) as a by-product of the lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate

    • Detect glycerol phosphate via a coupled enzymatic reaction with luciferase for luminescence readout

  • Assay components:

    • Purified recombinant C. jejuni lgt (0.1-1 μM)

    • Phosphatidylglycerol substrate (10-50 μM)

    • Synthetic peptide substrate derived from C. jejuni lipoprotein (e.g., Pal-IAAC) (5-20 μM)

    • Coupling enzymes for G1P/G3P detection

    • Assay buffer: 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM MgCl2, 0.1% DDM

  • Assay format:

    • 384-well microplate format

    • 20-30 μL reaction volume

    • Incubation time: 30-60 minutes at 37°C

    • Z'-factor target: >0.7 for assay robustness

Secondary Orthogonal Assays:

  • HPLC-MS detection of lipidated peptide:

    • Direct measurement of lipidated peptide product formation

    • Provides orthogonal confirmation of inhibition mechanism

  • GFP-based in vitro assay:

    • Monitor changes in fluorescence properties upon lipidation of GFP-fused substrate peptides

    • Provides visual confirmation of inhibition

  • Thermal shift assay:

    • Detect compound binding to lgt by changes in protein thermal stability

    • Filters out non-specific inhibitors

Counter-Screening Assays:

  • Enzyme selectivity panel:

    • Test against E. coli lgt and other bacterial lgt enzymes

    • Identify C. jejuni-specific inhibitors

  • Aggregation counter-screen:

    • Detergent-sensitive inhibition assay to identify promiscuous aggregators

    • Include 0.01% Triton X-100 to disrupt colloidal aggregates

  • Redox cycling compound filter:

    • Include catalase/SOD to identify false positives from redox cycling

Cell-Based Validation Assays:

  • C. jejuni growth inhibition:

    • Determine minimal inhibitory concentration (MIC) against C. jejuni

    • Correlate with enzymatic inhibition potency

  • E. coli lgt-knockout complementation:

    • Express C. jejuni lgt in E. coli lgt conditional knockout

    • Test compound efficacy in this system

  • Membrane permeability assessment:

    • Monitor outer membrane permeabilization using fluorescent dyes

    • Confirm on-target effects consistent with lgt inhibition

Data Analysis and Hit Selection:

  • Selection criteria:

    • Primary assay inhibition >70% at 10 μM

    • Confirmation in at least one orthogonal assay

    • Selectivity for C. jejuni lgt over E. coli lgt (>5-fold)

    • No activity in aggregation counter-screen

  • Structure-activity relationship analysis:

    • Group compounds by chemical scaffolds

    • Prioritize novel chemical matter with favorable physicochemical properties

This comprehensive screening cascade enables efficient identification of specific C. jejuni lgt inhibitors while minimizing false positives and providing early insights into mechanism of action .

How can isothermal titration calorimetry (ITC) be optimized to study the substrate binding kinetics of C. jejuni lgt?

Optimizing isothermal titration calorimetry (ITC) for studying C. jejuni lgt substrate binding requires careful consideration of the unique challenges presented by membrane proteins:

Sample Preparation Considerations:

  • Protein preparation:

    • Concentration range: 10-50 μM lgt in cell

    • Detergent selection: DDM at 2-3× critical micelle concentration (CMC)

    • Alternative systems to test: Nanodiscs, amphipols, or SMALPs for more native-like environment

    • Buffer: 50 mM HEPES or Tris-HCl pH 7.5, 150 mM NaCl, detergent at >CMC

  • Ligand preparation:

    • Phosphatidylglycerol concentration: 200-500 μM in syringe

    • Peptide substrate: 200-500 μM synthetic lipobox peptide

    • Match buffer and detergent conditions exactly with protein sample

    • Solubilize lipid substrates using the same detergent as protein

Experimental Parameters:

ParameterRecommended SettingRationale
Temperature25°CBalance between signal strength and protein stability
Reference power5-10 μcal/secAdjusted based on expected heat signals
Initial delay300 secondsAllow system equilibration
Stirring speed750-1000 rpmEnsure mixing without protein denaturation
Injection scheduleInitial: 0.5 μL, Then: 2-3 μL × 15-18 injectionsSmall first injection to clear air bubbles
Spacing between injections180-300 secondsAllow return to baseline

Control Experiments:

  • Essential controls:

    • Ligand into buffer (accounts for dilution heats)

    • Buffer into protein (baseline stability check)

    • Detergent mismatch control (critical for accurate background subtraction)

  • Validation controls:

    • Known substrate analog with established binding parameters

    • Catalytically inactive mutant (e.g., R143A based on E. coli homology)

    • Competition experiments with inhibitors

Data Analysis Considerations:

  • Model selection:

    • Single-site binding model as starting point

    • Evaluate sequential binding models if biphasic curves observed

    • Consider enzyme kinetics models for substrate binding

  • Parameter extraction:

    • Binding stoichiometry (n)

    • Dissociation constant (Kd)

    • Enthalpy change (ΔH)

    • Entropy change (ΔS)

    • Gibbs free energy change (ΔG)

  • Thermodynamic profile analysis:

    • Enthalpy-entropy compensation analysis

    • Temperature dependence to determine ΔCp

    • Correlation with structural features of binding sites

Troubleshooting Common Issues:

  • Low signal-to-noise ratio:

    • Increase protein concentration

    • Use higher c-value experiments (c = [protein]/Kd)

    • Consider nanodiscs for improved protein stability

  • Aggregation during titration:

    • Reduce protein concentration

    • Screen alternative detergents

    • Add glycerol (5-10%) to buffer

  • Multiple binding events:

    • Use displacement titration approach

    • Perform segmental titrations

    • Consider global fitting of multiple datasets

By carefully optimizing these parameters, ITC can provide valuable thermodynamic insights into C. jejuni lgt substrate recognition and binding kinetics, informing both mechanistic understanding and inhibitor design strategies.

How does inhibition of C. jejuni lgt compare to targeting other steps in lipoprotein biosynthesis as an antibacterial strategy?

Inhibition of different steps in the lipoprotein biosynthesis pathway offers distinct advantages and challenges as antibacterial strategies against C. jejuni:

Comparative Analysis of Lipoprotein Biosynthesis Targets:

Target EnzymeAdvantagesLimitationsCurrent Inhibitor Status
Lgt (first step)- Essential in most Gram-negative bacteria
- No rescue by lpp deletion
- Membrane permeabilization effect
- Increased sensitivity to serum killing and antibiotics
- Potentially narrow therapeutic window
- Challenging membrane protein target
First inhibitors recently identified
LspA (signal peptidase)- Well-characterized target
- Globomycin as validated inhibitor class
- Resistance through lpp deletion
- Less essential than lgt
Globomycin and improved analogs available
Lnt (N-acyltransferase)- Gram-negative specific
- Structural information available
- Less essential than lgt
- Variable requirement across species
Limited inhibitor development

Mechanistic Distinctions:

  • Unique aspects of lgt inhibition:

    • Unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors

    • Permeabilization of the outer membrane occurs rapidly upon lgt inhibition

    • Lgt inhibition leads to increased sensitivity to serum killing and antibiotics

  • Potential for synergistic approaches:

    • Combining lgt inhibitors with conventional antibiotics may enhance efficacy

    • Targeting multiple steps of the pathway simultaneously could reduce resistance development

  • Resistance development considerations:

    • On-target resistance to lgt inhibitors may be difficult to develop due to the essential nature of the enzyme and limited tolerance for mutations in the active site

    • Off-target resistance mechanisms like efflux may still develop

Campylobacter-Specific Considerations:

  • Unique aspects of C. jejuni physiology:

    • Spiral shape and distinct membrane composition may affect inhibitor access and efficacy

    • Phase variation and genomic plasticity may influence resistance development

    • Adaptation to different host environments may affect lipid composition and lipoprotein processing

  • Potential for narrow-spectrum targeting:

    • Differences between C. jejuni lgt and other bacterial orthologs could be exploited

    • Structural differences in binding sites might allow species-selective inhibition

  • Translational challenges:

    • Limited genetic manipulation tools for C. jejuni compared to E. coli

    • Complex growth requirements for validation studies

    • Microaerophilic nature complicates high-throughput screening

Based on the available data, inhibition of lgt represents a particularly promising antibacterial strategy against C. jejuni due to its essential nature and the apparent lack of bypass mechanisms that can provide resistance . The recent identification of the first lgt inhibitors that are bactericidal against wild-type bacteria further supports the potential of this approach .

What experimental approaches can determine the in vivo efficacy of recombinant C. jejuni lgt as a vaccine antigen?

Evaluating recombinant C. jejuni lgt as a vaccine antigen requires a systematic approach spanning from antigen preparation to protective efficacy assessment:

Antigen Preparation and Characterization:

  • Expression and purification strategies:

    • Full-length lgt vs. extramembrane domain fragments

    • Detergent-solubilized vs. nanodisc/liposome reconstitution

    • Adjuvant formulation optimization

  • Quality control assessments:

    • Structural integrity verification by circular dichroism

    • Functional activity confirmation via enzymatic assays

    • Endotoxin removal validation (<0.1 EU/dose)

Immunogenicity Assessment:

  • Animal models for initial testing:

    • Mouse models (BALB/c, C57BL/6)

    • Higher-order models (ferrets, non-human primates)

    • Focus on mucosal immunity (critical for gastrointestinal pathogens)

  • Immune response characterization:

    • Antibody response: titers, isotype profiling, avidity maturation

    • T-cell response: CD4+ (Th1/Th2/Th17), CD8+ activation

    • Mucosal immunity: secretory IgA in intestinal washes

    • Memory cell generation: long-term response sustainability

  • Antigen-specific assays:

    • ELISA for anti-lgt antibody detection

    • ELISpot for cytokine-producing T-cells

    • Flow cytometry for memory B and T-cell quantification

Protective Efficacy Evaluation:

  • Challenge models:

    • C57BL/6 IL-10-/- mouse model (established C. jejuni disease model)

    • Comparison with phase variable motility mutant strains as controls

    • Heterologous challenge with different C. jejuni strains to assess cross-protection

  • Protection metrics:

    • Bacterial colonization reduction (CFU counts in cecum/colon)

    • Disease symptom amelioration (histopathology scores)

    • Duration of shedding reduction

    • Prevention of bacteremia

  • Immune correlates of protection:

    • Neutralizing antibody assessment (enzymatic inhibition)

    • Antibody-dependent cellular cytotoxicity evaluation

    • Complement-mediated killing assays

Mechanistic Understanding:

  • Protection mechanism investigations:

    • Passive transfer studies with immune sera

    • Adoptive transfer with antigen-specific T-cells

    • Selective depletion of immune cell subsets

    • B-cell and T-cell knockout models

  • Cross-reactivity assessment:

    • Reactivity against lgt from different C. jejuni strains

    • Potential cross-reactivity with lgt from commensal bacteria

    • Epitope mapping to identify conserved protective regions

Translational Considerations:

  • Safety evaluation:

    • Autoimmunity risk assessment (mimicry with host proteins)

    • Local and systemic adverse event monitoring

    • Reproductive toxicity studies

  • Comparative studies:

    • Benchmarking against established C. jejuni vaccine candidates

    • Combination approaches with other antigens

    • Prime-boost strategies for enhanced immunity

This comprehensive experimental pipeline would provide definitive evidence regarding the potential of recombinant C. jejuni lgt as a vaccine antigen, identifying both its strengths and limitations for further development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.