Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Putative protein-disulfide oxidoreductase (CJJ81176_0881)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbI; CJJ81176_0881; Putative protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Target Names
dsbI
Target Protein Sequence
MSCIKMKDNCRNFSLSKWQDTRKPWLILIIVTIGLTCIAHFLFQEYLFMEPCEQCVYIRF
DMLVMAIGGMIALINPTNNIIKIFSYSLAFYGIWLGLEHCLTLNHIHEVVHSENPFAGVD
GCREIPIYPFNLPLHEWAPSWFLPIGECGMDTPVVPENAYNHLNAFQKFFIGTPPDFENG
LYSNGWYLIPSLKFINMAICCLIAFLCCFIVLFAMFIAYVLDKNKPNAKIFALAIVILVL
VLKFIGEPKNPNQNIASLNHLNQVVLRYS
Uniprot No.
Target Background
Function
Essential for disulfide bond formation in certain proteins. It functions as part of a DsbI/DsbL redox system, mediating the formation of a critical disulfide bond within AssT.
Database Links
KEGG: cjj:CJJ81176_0881
STRING: 354242.Cjejjejuni_010100004565
Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
