Recombinant Campylobacter jejuni subsp. jejuni serotype O:23/36 Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Genomic Studies

  • Genetic Diversity: Comparative genomic analyses reveal that uppP resides in highly variable regions of C. jejuni genomes, particularly in strains like 81-176 (serotype O:23/36) . These regions are associated with surface structure biosynthesis, including lipooligosaccharide (LOS) and capsular polysaccharides (CPS) .

  • Serotype Specificity: The O:23/36 serotype’s capsule biosynthesis locus shares homology with other O:23/36 strains (e.g., ATCC 43456), underscoring its role in serodetermination .

Role in Pathogenesis and Host Interaction

  • Cell Wall Integrity: uppP generates lipid carriers for peptidoglycan and CPS assembly, directly impacting bacterial survival and virulence .

  • Antibiotic Resistance: By recycling undecaprenyl phosphate, uppP contributes to bacitracin resistance, a trait critical for C. jejuni’s adaptation in hostile environments .

  • Host Immune Evasion: Mutations in uppP alter protein glycosylation patterns, potentially affecting antigenic profiles and immune recognition .

Applications in Vaccine Development

Recombinant uppP is a candidate antigen for anti-Campylobacter vaccines due to:

  • Surface Exposure: As a membrane-associated protein, uppP is accessible to host immune responses .

  • Conservation Across Strains: Despite genomic variability, core functional domains remain conserved, enabling broad-spectrum vaccine design .

  • Preclinical Validation: Studies demonstrate that targeting uppP disrupts bacterial cell wall synthesis, reducing colonization in animal models .

Challenges and Research Gaps

  • Structural Heterogeneity: Variations in uppP sequences across serotypes may complicate universal vaccine strategies .

  • Functional Redundancy: Backup pathways for undecaprenyl phosphate recycling could limit the efficacy of uppP-targeted therapies .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve uppP’s membrane-bound conformation .

  • Adjuvant Synergy: Pairing uppP with CPS or LOS antigens to enhance immunogenicity .

  • Antimicrobial Combinations: Testing uppP inhibitors alongside bacitracin or β-lactams .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
uppP; CJJ81176_0237; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Target Names
uppP
Target Protein Sequence
MENLYALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFIVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL
Uniprot No.

Target Background

Function

Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni uppP and what is its biological function?

Campylobacter jejuni uppP (Undecaprenyl-diphosphatase) is a critical membrane-bound enzyme that dephosphorylates undecaprenyl diphosphate to produce undecaprenyl phosphate (BP) . This enzymatic conversion represents a fundamental step in bacterial cell wall biosynthesis pathways. The enzyme functions within the bacterial membrane where polyprenol-dependent pathways are essential for the assembly of crucial glycoconjugates . Undecaprenyl-diphosphatase specifically catalyzes the removal of a phosphate group from C55 diphosphate, thereby generating the lipid carrier that serves as the platform for subsequent glycan assembly processes . In C. jejuni, this enzymatic activity is particularly important as it supports the biosynthesis of peptidoglycan and other bacterial surface polysaccharides that are essential for bacterial survival, virulence, and stress response .

What expression systems are appropriate for producing recombinant C. jejuni uppP?

Multiple expression systems have been validated for the production of recombinant C. jejuni uppP, each offering distinct advantages depending on research requirements. These include Escherichia coli, yeast, baculovirus, and mammalian cell expression systems . For basic biochemical characterization and structural studies, E. coli expression is often preferred due to its cost-effectiveness and high protein yield. When implementing an E. coli expression system, researchers typically culture cells at 37°C until reaching OD 0.6, then reduce temperature to 25°C before IPTG induction (1 mM), allowing expression to continue for 4 hours or overnight . Purification generally involves immobilized metal affinity chromatography using nickel columns with imidazole gradients (20 mM for binding, 50 mM for washing, and 500 mM for elution), followed by dialysis to remove excess imidazole . For studies requiring post-translational modifications or membrane protein folding, eukaryotic expression systems such as yeast or mammalian cells may provide advantages despite lower yields.

How does uppP integrate into bacterial polysaccharide biosynthesis pathways?

Undecaprenyl-diphosphatase (uppP) occupies a strategic position in bacterial polysaccharide biosynthesis by generating the essential lipid carrier undecaprenyl phosphate. This carrier serves as the membrane anchor for assembling glycoconjugates before their translocation across the bacterial membrane . In the context of C. jejuni's biosynthetic machinery, uppP functions downstream of undecaprenyl pyrophosphate synthase (UPPS), which synthesizes the C55 diphosphate substrate . The dephosphorylation reaction catalyzed by uppP creates the lipid carrier that subsequently accepts glycan moieties transferred by glycosyltransferases to build complex polysaccharide structures . This process is fundamental to the synthesis of peptidoglycan components, which are assembled on the membrane-anchored undecaprenyl-diphosphate before incorporation into the cell wall . The pathway also contributes to the production of the capsular polysaccharides and other surface glycans that enable C. jejuni to survive environmental stresses and establish infections .

How is C. jejuni uppP's role in pathogenesis currently understood?

The pathogenic potential of C. jejuni is closely linked to its ability to produce various surface polysaccharides, with uppP playing an indirect but crucial role in this process. As C. jejuni is one of the leading causes of bacterial foodborne disease worldwide, understanding the molecular mechanisms of its pathogenicity is essential . UppP contributes to pathogenesis by facilitating the biosynthesis of cell surface polysaccharides that participate in stress survival, transmission, and virulence . These surface structures help C. jejuni colonize host tissues, evade immune responses, and form biofilms that enhance environmental persistence and antibiotic resistance . Specific infections associated with C. jejuni include gastroenteritis and, in some cases, more severe complications such as Guillain-Barré syndrome, reactive arthritis, and irritable bowel syndrome . The enzyme's involvement in these essential biosynthetic pathways makes it a potential target for therapeutic intervention, as inhibiting uppP could disrupt cell wall integrity and potentially attenuate bacterial virulence.

What methodologies can be applied to study C. jejuni uppP in membrane environments?

Studying membrane-bound enzymes like C. jejuni uppP presents significant challenges due to their hydrophobic nature and dependence on the lipid environment for proper folding and function. Advanced methodologies to address these challenges include nanodisc technology, which has emerged as a powerful platform for investigating membrane proteins in a controlled lipid bilayer environment . Nanodiscs provide a native-like membrane setting where both the enzyme and its lipid substrates can be incorporated simultaneously, allowing for the study of their interactions under more physiologically relevant conditions .

To implement this approach, researchers can follow these methodological steps:

  • Protein reconstitution: Purified uppP is incorporated into nanodiscs along with specific phospholipids to mimic the bacterial membrane composition.

  • Substrate incorporation: Isotopic labeling of undecaprenyl-phosphate enables tracking of substrate incorporation into the nanodiscs containing uppP .

  • Functional assessment: Biochemical activity assays can confirm that the reconstituted enzyme retains its dephosphorylation capacity within the nanodisc system .

  • Interaction studies: Fluorescence-based approaches can be employed to monitor protein-lipid interactions and enzyme dynamics within the membrane environment .

This methodological framework provides a means to simultaneously assess the interactions between uppP, its substrates, and the lipid bilayer, offering unprecedented insights into the molecular mechanisms of membrane-bound glycan assembly pathways .

How does the activity of uppP influence biofilm formation in C. jejuni?

The relationship between uppP activity and biofilm formation in C. jejuni represents a complex area of investigation with important implications for bacterial persistence. Research indicates that surface polysaccharides, whose biosynthesis depends on uppP-generated lipid carriers, play critical roles in biofilm development . Studies have demonstrated correlations between polysaccharide production and biofilm formation through multiple experimental approaches:

  • Crystal violet staining: Quantitative assessment of biofilm biomass has revealed connections between surface polysaccharide expression and biofilm-forming capacity .

  • Scanning electron microscopy (SEM): Detailed visualization of biofilm architecture has shown structural differences related to polysaccharide composition .

  • Confocal microscopy: Analysis of biofilm spatial organization and matrix components has identified polysaccharide-dependent features .

Notably, research on the stringent response (SR) mutant ΔspoT in C. jejuni has provided valuable insights, as this mutant exhibits upregulated biofilm formation, representing the first SR mutant in any bacterial species identified with this phenotype . The calcofluor white (CFW) reactivity of C. jejuni, indicating the presence of surface polysaccharides with β1-3 and/or β1-4 linkages, increases under specific growth conditions (extended growth, 42°C anaerobic conditions) and in the ΔspoT mutant, suggesting that these conditions promote biofilm-associated polysaccharide production . These findings highlight the potential role of uppP in supporting the biosynthesis of biofilm matrix components, although further research is needed to elucidate the precise molecular mechanisms involved.

How do substrate specificities differ between uppP homologs from different bacterial species?

Comparative analysis of substrate specificities among bacterial undecaprenyl-diphosphatases reveals important species-specific variations that have implications for both basic research and antimicrobial development. While the search results don't provide direct comparisons of uppP from different species, related research on undecaprenyl pyrophosphate synthase (UPPS), another enzyme in the same pathway, offers valuable insights into species-specific substrate preferences .

Studies comparing UPPS from the mammalian symbiont Bacteroides fragilis, the human pathogen Vibrio vulnificus, and the opportunistic pathogen Escherichia coli have demonstrated notable differences in substrate selectivity . For example:

  • The anthranilamide-containing substrate 2-amideanilinogeranyl diphosphate (2AA-GPP) was effective only for B. fragilis UPPS.

  • Replacing the amide with a nitrile (2-nitrileanilinogeranyl diphosphate, 2CNA-GPP) created a substrate that was functional for UPPS from all three target organisms .

These observations suggest that even highly conserved enzymes involved in bacterial cell wall biosynthesis can exhibit significant species-specific differences in substrate recognition and processing. By extrapolation, it is reasonable to hypothesize that C. jejuni uppP may also possess unique substrate preferences or catalytic properties compared to homologs from other bacterial species. Understanding these differences could potentially inform the development of species-selective inhibitors targeting C. jejuni uppP without affecting commensal bacteria.

What are recommended protocols for assessing C. jejuni uppP enzymatic activity?

Assessing the enzymatic activity of C. jejuni uppP requires specialized methodologies that account for its membrane-associated nature and specific substrate requirements. Based on current research approaches, the following protocol framework is recommended:

Fluorescence-Based Assay Protocol:

  • Substrate preparation: While direct information on uppP substrate preparation is limited in the search results, related research suggests that fluorescently labeled substrates, similar to the approach used for UPPS activity measurement, could be adapted for uppP . Specifically, researchers have developed substrates like 2-nitrileanilinogeranyl diphosphate (2CNA-GPP) that undergo increases in fluorescence upon enzymatic processing .

  • Reaction conditions: Typical reaction conditions include:

    • Buffer: 50 mM Tris-HCl (pH 8.0), 200 mM NaCl

    • Temperature: 25-37°C (depending on specific experimental requirements)

    • Incubation time: 30-60 minutes

  • Activity monitoring: Fluorescence measurements (excitation/emission wavelengths dependent on the specific fluorescent substrate) taken at regular intervals to track reaction progression .

  • Data analysis: Quantification of enzymatic activity by calculating the rate of fluorescence change, which correlates with the dephosphorylation of the substrate.

This approach enables high-throughput screening in 96-well plate formats, making it suitable for inhibitor screening or comparative studies of enzyme variants . For more detailed biochemical characterization, HPLC methods monitoring at 260 nm absorbance can provide precise substrate-product quantification, as demonstrated for related enzymatic reactions .

How can isotopic labeling be used to track undecaprenyl-phosphate in membrane systems?

Isotopic labeling represents a powerful approach for tracking undecaprenyl-phosphate and studying its interactions with uppP in membrane systems. This methodology is particularly valuable because it allows researchers to follow specific molecules within complex biological environments. Based on available research strategies, the following methodological framework is recommended:

  • Substrate preparation: Synthesize isotopically labeled undecaprenyl-phosphate using stable isotopes such as 13C, 15N, or deuterium at specific positions in the molecule. The isotopic labeling should be strategically placed to minimize effects on molecular recognition while maximizing detection sensitivity.

  • Nanodisc incorporation: Co-incorporate the labeled undecaprenyl-phosphate into nanodiscs along with purified uppP enzyme and appropriate phospholipids to create a controlled membrane environment . Research has demonstrated that this approach enables the study of membrane-bound glycan assembly pathways in a physiologically relevant context .

  • Analytical techniques: Several complementary techniques can be employed to track the labeled substrate:

    • Mass spectrometry: For identification and quantification of labeled compounds and their metabolites

    • NMR spectroscopy: For structural characterization and monitoring of enzymatic reactions

    • Fluorescence microscopy: When combined with fluorescent tags for visualization of substrate localization

This isotopic labeling approach has been successfully applied to demonstrate the colocalization of enzymes and substrates in nanodiscs, revealing that undecaprenyl-phosphate can be coincorporated into discs with enzymes involved in membrane-committed steps of glycan assembly . This methodology provides unique insights into the spatial organization and dynamics of polyprenol-dependent pathways that would be difficult to obtain through other experimental approaches.

What fluorescence-based approaches can be used to study uppP interactions with membrane components?

Fluorescence-based methodologies offer powerful tools for investigating the interactions between uppP, its substrates, and membrane components. While specific information about fluorescence approaches for C. jejuni uppP is limited in the search results, related research on polyprenol-dependent pathways provides valuable methodological insights that can be adapted for uppP studies .

Recommended Fluorescence Methodologies:

  • Fluorescent substrate analogs: Development of fluorescent analogs of undecaprenyl diphosphate that change their spectral properties upon enzymatic processing by uppP. Research on related enzymes has shown that 2-nitrileanilinogeranyl diphosphate (2CNA-GPP) undergoes a 2.5-fold increase in fluorescence upon chain elongation, making it an effective probe for enzymatic activity . Similar substrate design principles could be applied to create fluorescent probes specific for uppP activity.

  • FRET-based interaction studies: Implementation of Förster Resonance Energy Transfer (FRET) approaches by strategically labeling uppP and its substrate or interacting proteins with appropriate fluorophore pairs. This allows for real-time monitoring of protein-protein or protein-substrate interactions within the membrane environment.

  • Fluorescence anisotropy: Measurement of changes in the rotational mobility of fluorescently labeled substrates upon binding to uppP, providing information about binding kinetics and affinity.

  • Nanodisc-based fluorescence approaches: Integration of fluorescence techniques with the nanodisc platform, which has been successfully used to study membrane protein interactions in controlled lipid environments . This combined approach enables simultaneous assessment of enzyme-substrate interactions and membrane effects.

These fluorescence-based methodologies have been successfully applied to investigate related polyprenol-dependent pathways and can be adapted to study the specific interactions and activities of C. jejuni uppP in membrane systems .

What structural and functional characteristics distinguish serotype O:23/36 uppP from other C. jejuni variants?

The structural and functional characteristics that distinguish serotype O:23/36 uppP from other C. jejuni variants represent an important area of investigation, particularly given the serotype-specific variations in C. jejuni pathogenicity and host interactions. While detailed comparative information about uppP across different C. jejuni serotypes is limited in the search results, several insights can be derived from the available data.

C. jejuni serotype O:23/36 (strain 81-176) uppP is characterized as an undecaprenyl-diphosphatase consisting of 267 amino acids . This enzyme plays a critical role in the dephosphorylation of undecaprenyl diphosphate, generating the lipid carrier essential for polysaccharide biosynthesis . The specific serotype designation O:23/36 refers to surface antigenic determinants, which are often associated with the lipooligosaccharides and capsular polysaccharides whose biosynthesis depends on uppP activity .

Research on C. jejuni capsular loci has revealed "multiple mechanisms for the generation of structural diversity and the ability to form complex heptoses," suggesting potential serotype-specific variations in polysaccharide biosynthesis pathways that might influence uppP function or regulation . Additionally, the identification of distinct surface polysaccharides in C. jejuni that are independent of well-characterized lipooligosaccharides, capsular polysaccharides, and N-linked polysaccharides suggests complex and potentially serotype-specific polysaccharide biosynthesis mechanisms .

While further research is needed to fully characterize the serotype-specific features of C. jejuni uppP, these findings highlight the importance of considering serotype designation when investigating this enzyme's structure, function, and role in bacterial physiology and pathogenesis.

What are promising strategies for targeting C. jejuni uppP in antimicrobial development?

The critical role of uppP in bacterial cell wall biosynthesis makes it an attractive target for novel antimicrobial development against C. jejuni infections. Based on current understanding of bacterial polyprenol-dependent pathways, several promising strategies can be proposed:

  • Structure-based inhibitor design: Elucidation of C. jejuni uppP's three-dimensional structure through X-ray crystallography or cryo-electron microscopy would enable rational design of inhibitors that specifically target its active site. This approach has been successful for related enzymes in bacterial cell wall biosynthesis pathways .

  • Fluorescence-based high-throughput screening: Development of fluorescent substrate analogs that undergo spectral changes upon enzymatic processing by uppP could facilitate high-throughput screening of chemical libraries to identify potential inhibitors . Similar approaches with 2-nitrileanilinogeranyl diphosphate (2CNA-GPP) have been successful for related enzymes, where fluorescence increases of 2.5-fold upon enzymatic processing enabled effective inhibitor screening in 96-well plate formats .

  • Nanodisc-based drug discovery platform: Utilization of the nanodisc membrane platform to evaluate potential inhibitors in a physiologically relevant environment that recreates the membrane context in which uppP naturally functions . This approach allows for simultaneous assessment of inhibitor binding, membrane permeability, and enzymatic inhibition.

  • Species-selective inhibitor development: Exploitation of substrate specificity differences between C. jejuni uppP and related enzymes from commensal bacteria to develop inhibitors that selectively target pathogenic C. jejuni while preserving beneficial gut microbiota . Research on related enzymes has demonstrated significant species differences in alternative substrate utilization, suggesting the feasibility of this approach .

  • Biofilm disruption strategies: Development of compounds that inhibit uppP-dependent polysaccharide production could potentially disrupt C. jejuni biofilm formation, enhancing the effectiveness of conventional antibiotics against biofilm-associated infections .

These strategies, particularly when combined with advanced understanding of C. jejuni's specific pathogenic mechanisms and membrane biology, offer promising avenues for developing targeted antimicrobials against this important foodborne pathogen.

How might advances in membrane protein research technologies enhance our understanding of uppP function?

Emerging technologies in membrane protein research are poised to significantly advance our understanding of C. jejuni uppP function and its role in bacterial physiology. Several promising technological approaches include:

  • Advanced nanodisc technologies: Further refinement of nanodisc platforms to more precisely control lipid composition, size, and membrane protein density could provide unprecedented insights into uppP function in defined membrane environments . Recent advances in nanodisc technology now allow for the incorporation of multiple membrane proteins simultaneously, enabling the study of entire membrane-bound enzymatic pathways in which uppP participates .

  • Single-molecule fluorescence techniques: Application of methods such as single-molecule FRET (smFRET) or fluorescence correlation spectroscopy (FCS) to study the dynamics of individual uppP molecules within membrane environments. These approaches could reveal conformational changes, substrate binding events, and catalytic cycling at unprecedented resolution.

  • Native mass spectrometry: Implementation of emerging native mass spectrometry techniques for membrane proteins could enable direct analysis of uppP-substrate complexes, protein-protein interactions, and post-translational modifications in near-native states.

  • In situ structural biology: Development of methods to study membrane proteins in their native cellular environments, such as cryo-electron tomography or in-cell NMR spectroscopy, could provide structural and functional information about uppP under physiologically relevant conditions.

  • Integrated multi-omics approaches: Combination of proteomics, lipidomics, and glycomics to comprehensively characterize how uppP activity influences the broader bacterial cell envelope composition and dynamics under various environmental conditions.

These technological advances, particularly when applied in combination, promise to overcome current limitations in studying membrane-bound enzymes like uppP, potentially revealing new aspects of its function, regulation, and interactions within the complex bacterial cell envelope that could inform both basic microbiology and antimicrobial development efforts.

Comparison of Expression Systems for Recombinant C. jejuni uppP Production

Expression SystemAdvantagesLimitationsOptimal Culture ConditionsPurification Method
E. coliHigh yield, cost-effective, well-established protocolsLimited post-translational modifications, potential inclusion body formationGrowth at 37°C until OD 0.6, temperature shift to 25°C, 1 mM IPTG induction for 4h or overnight Ni-NTA affinity chromatography with imidazole gradient (20 mM binding, 50 mM wash, 500 mM elution)
YeastPost-translational modifications, proper folding of complex proteinsLower yield, longer production timeStrain and construct dependentAffinity chromatography, often requires optimization
BaculovirusExcellent for complex membrane proteins, post-translational modificationsTechnical complexity, higher cost, longer production timeInsect cell specific media, 27-28°CMulti-step chromatography often necessary
Mammalian CellNative-like modifications, suitable for functional studiesLowest yield, highest cost, technical expertise requiredCell line specific media, 37°C, 5% CO2Gentle extraction methods, multi-step purification

Experimental Approaches for Studying C. jejuni uppP in Membrane Environments

Methodological ApproachKey ApplicationsTechnical RequirementsAdvantagesLimitations
Nanodisc ReconstitutionFunctional studies, protein-lipid interactions Purified protein, membrane scaffold proteins, defined lipidsControlled membrane environment, stability, suitable for various analytical techniques Complex assembly, potential loss of native interactions
Isotopic LabelingTracking substrate incorporation and metabolism Isotopically labeled precursors, analytical detection methodsDirect visualization of substrate fate, compatibility with various detection methods Technical complexity, cost, specialized equipment
Fluorescence-Based AssaysEnzyme kinetics, inhibitor screening Fluorescent substrate analogs, spectrofluorometerHigh sensitivity, real-time measurements, adaptable to high-throughput formats Potential interference from substrate modifications, background fluorescence
Biochemical Activity AssaysQuantitative enzyme characterizationPurified enzyme, substrate, appropriate detection methodDirect measurement of enzymatic activity, standardized protocolsMay not reflect in vivo activity, limited throughput

These tables provide structured comparisons of methodological approaches for studying C. jejuni uppP, offering researchers a framework for experimental design and technical implementation in this challenging but important area of bacterial physiology research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.