Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Nomenclature

The atpB protein from C. jejuni is formally known by several names in scientific literature and databases:

  • ATP synthase subunit a

  • ATP synthase F0 sector subunit a

  • F-ATPase subunit 6

The gene encoding this protein is designated as atpB, with specific locus names such as CJE1338 or C8J_1147 depending on the strain reference .

Expression Systems and Methods

The recombinant form of C. jejuni atpB is typically produced using Escherichia coli expression systems, which provide efficient production of bacterial membrane proteins . This heterologous expression approach involves cloning the atpB gene into appropriate expression vectors and transforming them into E. coli host cells optimized for membrane protein production.

The recombinant protein is commonly produced with affinity tags, particularly histidine (His) tags, to facilitate purification through affinity chromatography . The full-length protein (amino acids 1-226) is expressed with the tag typically located at the N-terminus to minimize interference with the protein's membrane-spanning domains.

Physical and Biochemical Properties

Table 1 summarizes the key characteristics of recombinant C. jejuni atpB protein:

PropertyDescription
SpeciesCampylobacter jejuni subsp. jejuni serotype O:6
Protein LengthFull Length (1-226 amino acids)
TagHis (N-terminal)
Expression SystemE. coli
Physical FormLyophilized powder
UniProt IDA8FMQ9 / Q5HTR0 (strain-dependent)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0 or Tris-based buffer with 50% glycerol
Purity>90% (as determined by SDS-PAGE)

The recombinant protein is typically supplied as a lyophilized powder that requires reconstitution before use in experimental applications .

ATP Synthesis Mechanism

ATP synthase subunit a (atpB) plays a crucial role in the F0F1-ATP synthase complex, which is responsible for ATP synthesis in bacteria. The protein forms part of the membrane-embedded F0 sector that creates a proton channel across the bacterial membrane. This channel allows protons to flow down their concentration gradient, with the energy from this movement driving the rotation of the F1 sector to catalyze ATP synthesis .

The hydrophobic nature of atpB and its multiple transmembrane domains are essential for maintaining the proton pathway and ensuring proper coupling between proton translocation and ATP synthesis .

ATP Synthase Components in Bacterial Systems

The ATP synthase complex in bacteria contains multiple subunits organized into two major sectors: F1 (containing the catalytic sites for ATP synthesis) and F0 (forming the membrane-embedded proton channel). The atpB protein is one of several subunits that make up the F0 sector, working together with other components to couple proton movement to ATP synthesis .

Research on various components of bacterial ATP synthases has revealed that these complexes are highly conserved across species but contain specific adaptations that may reflect ecological niches and pathogenic potential .

Current Applications

Recombinant C. jejuni atpB protein has several important research applications:

  1. Structural studies of bacterial ATP synthase components

  2. Development of antibodies against specific C. jejuni proteins

  3. Investigation of energy metabolism in foodborne pathogens

  4. Identification of potential antimicrobial targets

The availability of purified recombinant protein facilitates these studies by providing material for biochemical and structural analyses that would be difficult to perform with native protein from bacterial cultures .

Potential Therapeutic Relevance

Given the essential role of ATP synthase in bacterial survival, components such as atpB represent potential targets for antimicrobial development. Specific inhibitors of ATP synthase function could disrupt energy metabolism in C. jejuni, potentially leading to new approaches for controlling this important foodborne pathogen .

Recent genomic studies have revealed considerable diversity among C. jejuni isolates, with multiple sequence types (STs) identified across clinical and environmental samples . This genetic diversity may extend to energy metabolism components, including ATP synthase subunits, potentially influencing bacterial fitness and pathogenicity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; C8J_1147; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Target Names
atpB
Target Protein Sequence
MKDLFLFSSLLDASHTFSYFFHIGLVALIAVIVAMMATRSMQLVPRGMQNLGEAFLEGVL SMGRDTMGSEKGARKYLPLVATLGIIVFFSNIIGIIPGFHAPTASLNLTLSLAIIVFVYY HFEGIRAQGFVKYFAHFMGPIKLLAPLMFPIEIVSHLSRVVSLSFRLFGNIKGDDLFLMV ILALVPYIAPLPAYVLLTFMAFLQAFIFMILTYVYLAGATVVEEGH
Uniprot No.

Target Background

Function
This protein plays a crucial role in the proton channel, directly facilitating the translocation of protons across the membrane.
Database Links

KEGG: cju:C8J_1147

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ATP synthase subunit a (atpB) in Campylobacter jejuni?

ATP synthase subunit a (atpB) in C. jejuni forms a critical component of the F₀ domain located in the inner membrane. This subunit creates a pathway for proton translocation across the membrane and works in conjunction with the c-ring to convert the proton motive force (pmf) into mechanical rotation. This rotation ultimately drives ATP synthesis in the F₁ domain.

The subunit a functions by using the energy created by the proton electrochemical gradient to enable phosphorylation of ADP to ATP . In C. jejuni specifically, this process is closely linked to the organism's branched electron transport chain, which enables respiration with various electron donors and acceptors . The subunit provides a crucial physical connection between the proton channel and other components of the peripheral stalk in the ATP synthase complex .

How does the structure of C. jejuni atpB differ from other bacterial ATP synthase subunit a proteins?

While specific structural information for C. jejuni atpB isn't extensively characterized in the provided search results, research indicates that ATP synthase architecture is generally conserved across species but contains organism-specific adaptations.

In C. jejuni, the ATP synthase complex exhibits adaptations related to its microaerophilic lifestyle. The subunit a in C. jejuni likely contains specific amino acid residues that facilitate proton translocation under the unique conditions of its ecological niche. C. jejuni's ability to generate a relatively high membrane potential (Δψ) only under specific respiratory conditions (with either formate as electron donor or oxygen as electron acceptor) suggests structural adaptations in its ATP synthase components, including atpB, that optimize function in these conditions .

The peripheral stalk, which includes interactions with subunit a, is particularly important for the stability of the c-ring/F₁ complex in the ATP synthase assembly . This suggests that the structure of atpB in C. jejuni may have evolved to ensure optimal stability and function in the variable environments encountered during its lifecycle.

What are the most effective methods for recombinant expression of C. jejuni atpB?

Based on established protocols for recombinant C. jejuni proteins, the most effective expression systems for atpB include:

E. coli Expression System:

  • Utilize E. coli expression strains optimized for membrane proteins (such as C41(DE3) or C43(DE3))

  • Employ vectors with inducible promoters (such as pET series) with appropriate fusion tags (His6, MBP, or SUMO) to facilitate purification

  • Grow cultures at reduced temperatures (16-25°C) after induction to enhance proper folding

  • Supplement with specialized media components to enhance membrane protein expression

Similar to recombinant expression approaches used for other C. jejuni proteins, the source organism can be selected from E. coli, yeast, baculovirus, or mammalian cell systems . For membrane proteins like atpB, detergent screening is crucial for solubilization and maintaining protein stability.

To optimize expression, researchers should:

  • Test multiple fusion constructs with varying N- and C-terminal boundaries

  • Evaluate expression using Western blotting with anti-His (or appropriate tag) antibodies

  • Assess protein folding through activity assays following purification

  • Use blue native PAGE to examine proper integration into the ATP synthase complex

What purification strategies yield the highest purity and structural integrity for recombinant C. jejuni atpB?

Purification of membrane proteins like atpB requires specialized approaches:

Recommended Purification Protocol:

  • Membrane Fraction Isolation:

    • Disrupt cells using sonication or high-pressure homogenization

    • Isolate membrane fraction through differential centrifugation

  • Solubilization:

    • Test multiple detergents (DDM, LMNG, Digitonin) at various concentrations

    • Include appropriate salt concentration (150-300 mM NaCl) and glycerol (10-20%) for stability

  • Affinity Chromatography:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Apply imidazole gradient elution to minimize co-purification of contaminants

  • Size Exclusion Chromatography:

    • Remove aggregates and assess oligomeric state

    • Buffer optimization to maintain protein stability

  • Quality Assessment:

    • SDS-PAGE and Western blotting

    • Mass spectrometry verification

    • Functional assays to confirm activity

For structural studies, techniques such as blue native PAGE can be employed to assess proper complex assembly, similar to methods used in studies of mitochondrial ATP synthase . Maintaining the protein in appropriate detergent micelles or reconstituting it into nanodiscs can preserve structural integrity for downstream applications.

How can researchers effectively analyze the interaction between atpB and other ATP synthase subunits in C. jejuni?

To analyze subunit interactions within the C. jejuni ATP synthase complex:

Co-immunoprecipitation Approaches:

  • Use antibodies against tagged atpB or other subunits to pull down interacting partners

  • Analyze co-precipitated proteins by mass spectrometry

  • Confirm direct interactions using crosslinking approaches followed by MS/MS analysis

Genetic Approaches:

  • Generate conditional knockdowns or temperature-sensitive mutants

  • Analyze effects on complex assembly using blue native PAGE

  • Perform complementation studies with mutated atpB variants

Structural Biology Methods:

  • Cryo-electron microscopy of the entire ATP synthase complex

  • Crosslinking mass spectrometry to map interaction interfaces

  • Site-directed mutagenesis of predicted interaction sites followed by functional assays

Studies examining ATP synthase assembly have established that the peripheral stalk components are critical for the stability of the c-ring/F₁ complex . Applied to C. jejuni, researchers can use similar approaches to determine if atpB follows the proposed assembly model where the c-ring forms first, followed by binding of F₁, the stator arm, and finally subunits a and A6L . This would provide insights into the specific role of atpB in complex assembly and stability.

How does atpB contribute to C. jejuni pathogenicity and host colonization?

The ATP synthase subunit a (atpB) plays a crucial indirect role in C. jejuni pathogenicity through several mechanisms:

Energy Production for Virulence:
ATP synthase generates the ATP necessary for numerous virulence-associated processes. C. jejuni requires a robust energy production system to power flagellar motility, which is essential for colonization and invasion. Research has shown that C. jejuni depends on either formate/hydrogen as electron donors (in the anaerobic gut lumen) or oxygen as acceptor (near epithelial cells) to generate the proton motive force that sustains efficient motility and growth necessary for colonization and pathogenesis .

Membrane Potential Maintenance:
The atpB subunit is critical for maintaining the membrane potential (Δψ), which is essential for C. jejuni motility. Studies have demonstrated that a relatively high Δψ is only generated in the presence of specific electron donors (like formate) or acceptors (like oxygen) . This membrane potential drives the flagellar motor, which is essential for the bacterium to reach and colonize the intestinal mucosa.

Adaptation to Host Environment:
C. jejuni must adapt to varying oxygen concentrations within the host. Under low oxygen tension, C. jejuni increases the transcription and activity of specific donor complexes including formate dehydrogenase and hydrogenase . The ATP synthase complex, including atpB, works in concert with these respiratory components to maintain energy production under changing conditions in the gastrointestinal tract.

What is the relationship between atpB function and antimicrobial resistance in C. jejuni?

The relationship between ATP synthase function and antimicrobial resistance in C. jejuni involves several important connections:

Energy-Dependent Efflux Systems:
Many antimicrobial resistance mechanisms in C. jejuni, particularly efflux pumps, are energy-dependent and require ATP. As a component of ATP synthase, atpB indirectly contributes to these resistance mechanisms by helping generate the ATP necessary for their function.

Membrane Potential and Drug Uptake:
The membrane potential (Δψ), which atpB helps establish, affects the uptake of certain antimicrobials. Alterations in membrane potential can reduce the accumulation of positively charged antimicrobials within the cell.

Stress Response and Adaptation:
While specific mutations in atpB haven't been directly linked to antimicrobial resistance in the provided search results, genomic analysis of C. jejuni has revealed high levels of resistance to various antimicrobials:

  • 94.4% resistance to quinolones in C. jejuni isolates, higher than reports from the US but comparable to several European countries

  • 18.5% resistance to erythromycin in C. jejuni, higher than both US (4.0%) and European Union (2.0%) averages

  • High prevalence of the tetO gene (66.67%), conferring tetracycline resistance

The ATP synthase complex may indirectly contribute to this resistance by supporting cellular stress responses and adaptation mechanisms that allow C. jejuni to survive antimicrobial exposure.

What genetic variations in the atpB gene have been identified across C. jejuni strains, and what is their functional significance?

Genetic analysis of C. jejuni has revealed significant diversity across strains, with important implications for ATP synthase components:

MLST and Population Structure:
Multilocus sequence typing (MLST) analysis has identified high genetic diversity among C. jejuni strains, with numerous sequence types (STs) distributed across multiple clonal complexes. This genetic diversity extends to genes encoding ATP synthase components. For example, one study revealed that the ATP synthase alpha-subunit gene is among those analyzed in MLST schemes for Campylobacter .

Although the provided search results don't specifically detail atpB variations, whole genome sequencing studies of C. jejuni have identified:

  • Different populations with distinct genetic characteristics across geographic regions

  • Phylogenetic analysis showing C. jejuni strains divided into distinct clades and populations

Functional Implications:
The genetic diversity in atpB likely reflects adaptation to different ecological niches and hosts. Variations in this gene may affect:

  • Efficiency of proton translocation

  • Stability of the ATP synthase complex

  • Energy production under different environmental conditions

  • Interactions with other ATP synthase subunits

Research indicates that the energy production capabilities of C. jejuni are fine-tuned to its environment, as evident from its specialized electron transport chain that enables respiration with different electron donors and acceptors . These adaptations likely extend to variations in ATP synthase components including atpB.

How can researchers effectively use ATP synthase genes, including atpB, for molecular typing and evolutionary studies of C. jejuni?

ATP synthase genes provide valuable markers for molecular typing and evolutionary studies of C. jejuni:

Molecular Typing Applications:

  • Multi-Locus Sequence Typing (MLST):

    • ATP synthase genes can be incorporated into MLST schemes

    • The uncA gene (ATP synthase alpha-subunit) has been utilized in Campylobacter MLST analysis

    • Researchers analyzing MLST data found that of 3,693 isolates, 3,628 were assigned to C. jejuni and 65 to C. coli based on the uncA gene sequence

  • Single Gene Marker Development:

    • Conserved regions of atpB can be used to design species-specific primers

    • Variable regions can be targeted for strain differentiation

  • Whole Genome SNP Analysis:

    • ATP synthase genes can be included in core genome analyses

    • SNP patterns in these genes may reflect adaptation to specific hosts or environments

Evolutionary Study Methods:

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify positive or purifying selection

    • Map selection hotspots to functional domains of the protein

  • Comparative Genomics:

    • Compare atpB sequences across Campylobacter species

    • Identify lineage-specific variations that may reflect niche adaptation

  • Population Structure Analysis:

    • Integrate atpB variation data with other genetic markers

    • Apply phylogenetic methods to infer evolutionary relationships

This approach aligns with findings from genomic analysis of C. jejuni strains, which has revealed high genetic diversity with numerous sequence types. For example, one study identified 30 sequence types (STs) distributed across 11 clonal complexes for C. jejuni . The incorporation of ATP synthase genes like atpB into such analyses can provide additional resolution for understanding the evolutionary history and population structure of this pathogen.

How can researchers effectively use atpB as a target for developing novel antimicrobials against C. jejuni?

ATP synthase represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. Researchers can target atpB through several strategies:

Target Validation Approaches:

  • Generate conditional knockdowns to confirm essentiality under various conditions

  • Perform growth studies in different media to determine conditions where ATP synthase activity is most critical

  • Use structure-based design to identify potential binding sites unique to bacterial atpB

Screening Methodologies:

  • Develop high-throughput assays measuring ATP synthase activity in membrane preparations

  • Establish whole-cell assays monitoring membrane potential or ATP production

  • Use computational approaches to virtually screen compound libraries against modeled atpB structure

Specificity Considerations:
Researchers must address the challenge of selectivity between bacterial and human ATP synthases. This requires:

  • Detailed structural comparison between C. jejuni atpB and human ATP synthase subunit a

  • Identification of binding pockets unique to the bacterial protein

  • Structure-activity relationship studies to optimize compound selectivity

Given the high rates of antimicrobial resistance observed in C. jejuni (94.4% resistance to quinolones, 18.5% resistance to erythromycin) , targeting essential components like atpB may provide alternative treatment options. The effectiveness of this approach is supported by the fact that ATP synthase is critical for generating the membrane potential necessary for C. jejuni motility and growth , making it a physiologically validated target.

What are the technical challenges in determining the high-resolution structure of C. jejuni atpB, and how can they be overcome?

Determining the high-resolution structure of C. jejuni atpB presents significant technical challenges due to its nature as an integral membrane protein:

Key Challenges:

  • Protein Expression and Purification:

    • Low expression yields of membrane proteins

    • Maintaining structural integrity during solubilization

    • Preventing aggregation during purification

  • Structural Analysis Limitations:

    • Difficulty in obtaining well-diffracting crystals for X-ray crystallography

    • Challenges in sample preparation for cryo-EM

    • Size limitations for NMR studies of membrane proteins

  • Complex Assembly Context:

    • atpB functions within the multi-subunit ATP synthase complex

    • Native interactions with other subunits may be essential for proper folding

    • Lipid environment significantly impacts structure and function

Innovative Solutions:

  • Expression Strategies:

    • Utilize specialized E. coli strains designed for membrane protein expression

    • Explore alternative expression systems such as cell-free systems with lipid nanodiscs

    • Engineer fusion constructs with stability-enhancing partners

  • Advanced Structural Methods:

    • Apply integrative structural biology combining multiple techniques

    • Use single-particle cryo-EM for the entire ATP synthase complex

    • Employ solid-state NMR for specific structural elements

    • Apply crosslinking mass spectrometry to map interaction interfaces

  • Computational Approaches:

    • Develop homology models based on structures from related organisms

    • Use molecular dynamics simulations to predict structural dynamics

    • Apply machine learning techniques to predict structure from sequence

Drawing from approaches used to study mitochondrial ATP synthase , researchers can adapt these methods to determine the structure of C. jejuni atpB, accounting for its specific properties as a bacterial membrane protein.

What methods are most reliable for measuring atpB-mediated proton translocation in C. jejuni?

Measuring proton translocation mediated by atpB in C. jejuni requires specialized techniques:

Membrane Vesicle Assays:

  • Prepare inside-out membrane vesicles from C. jejuni

  • Monitor pH changes using pH-sensitive fluorescent dyes (ACMA, pyranine)

  • Measure proton translocation upon addition of ATP or establishment of a membrane potential

Whole-Cell Approaches:

  • Use pH-sensitive fluorescent proteins expressed in C. jejuni

  • Apply patch-clamp techniques to measure membrane currents

  • Monitor internal pH using ratiometric fluorescent dyes

Reconstitution Systems:

  • Purify ATP synthase components and reconstitute in liposomes

  • Measure proton pumping activity using pH indicators

  • Assess the effect of atpB mutations on proton translocation efficiency

Research on C. jejuni has established methods for measuring membrane potential (Δψ) that could be adapted to study atpB function specifically. Studies have shown that C. jejuni generates a relatively high Δψ only in the presence of either formate as electron donor or oxygen as electron acceptor . These established approaches provide a foundation for developing atpB-specific functional assays.

A table summarizing optimal conditions for proton translocation assays:

Assay TypeBuffer CompositionDetection MethodAdvantagesLimitations
Inside-out vesicles10 mM HEPES, 100 mM KCl, 5 mM MgCl₂, pH 7.5ACMA fluorescence quenchingNative membrane environmentVariable vesicle formation
Reconstituted liposomes20 mM Tricine, 20 mM succinic acid, 80 mM NaCl, 0.6 mM KOH, pH 8.0Pyranine fluorescenceDefined compositionComplex preparation
Whole cellsPBS with 5 mM glucosepHluorin fluorescencePhysiological relevanceBackground interference

How does the C. jejuni atpB interact with the c-ring during ATP synthesis, and what experimental approaches can elucidate this interaction?

The interaction between atpB and the c-ring is crucial for ATP synthesis in C. jejuni:

Functional Relationship:
Subunit a (atpB) and the c-ring together form the proton translocation pathway in the F₀ domain of ATP synthase. This interaction is essential for converting the proton motive force into rotational motion that drives ATP synthesis in the F₁ domain. Research indicates that in ATP synthase assembly, the c-ring forms first, followed by the addition of F₁, the stator arm, and finally subunits a and A6L .

Experimental Approaches to Study the Interaction:

  • Site-Directed Mutagenesis:

    • Introduce mutations at predicted interaction sites in atpB

    • Assess effects on ATP synthesis activity and proton translocation

    • Identify residues critical for functional interaction

  • Crosslinking Studies:

    • Design crosslinking experiments targeting the atpB-c-ring interface

    • Analyze crosslinked products by mass spectrometry

    • Map the interaction surface between the two components

  • Structural Biology Approaches:

    • Apply cryo-EM to visualize the entire ATP synthase complex

    • Use molecular dynamics simulations to model the dynamic interaction

    • Perform hydrogen-deuterium exchange mass spectrometry to identify protected regions

  • Genetic Suppressor Analysis:

    • Identify mutations in atpB that disrupt function

    • Screen for compensatory mutations in c-subunits that restore function

    • Map the functional interaction network between the proteins

This approach builds on established knowledge of ATP synthase assembly, where it has been proposed that assembly in yeast involves separate pathways that converge at the end stage . Similar principles likely apply to C. jejuni, with atpB joining the complex at a late stage to form the functional proton channel with the c-ring.

How is the expression of atpB regulated in C. jejuni under different environmental conditions?

The regulation of ATP synthase components, including atpB, in C. jejuni shows sophisticated adaptation to environmental conditions:

Oxygen-Dependent Regulation:
C. jejuni demonstrates remarkable adaptability to varying oxygen levels. In response to low oxygen tension, C. jejuni increases the transcription of various respiratory complexes . This adaptive response likely extends to ATP synthase components, including atpB, to optimize energy production under microaerobic or anaerobic conditions encountered in the host gastrointestinal tract.

Nutrient-Responsive Regulation:
ATP synthase expression responds to available energy sources. Research has shown that C. jejuni can utilize different electron donors (formate, hydrogen) and acceptors (oxygen, alternative acceptors) to generate a membrane potential . The regulation of ATP synthase likely coordinates with these respiratory pathways to maximize energy efficiency.

Host-Associated Factors:
During host colonization, C. jejuni faces various stresses that may influence ATP synthase expression. While specific data on atpB regulation during infection isn't provided in the search results, the importance of ATP synthase for growth and motility suggests that its expression is maintained during colonization to support these essential functions.

Transcriptional and Post-Transcriptional Control:
Drawing parallels from yeast studies, expression of ATP synthase subunits may be translationally regulated to achieve balanced output between nuclear-encoded and mtDNA-encoded subunits . Similar coordinated regulation likely exists in C. jejuni to ensure proper stoichiometry of ATP synthase components.

What role does atpB play in C. jejuni adaptation to different host environments during infection?

ATP synthase subunit a (atpB) contributes significantly to C. jejuni's ability to adapt to diverse host environments:

Adaptation to Oxygen Gradients:
C. jejuni encounters varying oxygen concentrations in the host gastrointestinal tract. Research has established that C. jejuni requires either formate/hydrogen as donors (in the anaerobic lumen) or oxygen as acceptor (near epithelial cells) to generate a sufficient proton motive force for motility and growth . The ATP synthase complex, including atpB, plays a crucial role in converting this proton motive force into ATP, supporting adaptation to these different microenvironments.

Energy Conservation in Nutrient-Limited Conditions:
Within the host, C. jejuni may face nutrient limitations. ATP synthase function becomes particularly important under these conditions, as efficient energy conservation through oxidative phosphorylation supports survival. The atpB subunit's role in proton translocation directly contributes to this energy conservation mechanism.

Supporting Virulence Factor Expression:
ATP production is essential for the expression and function of virulence factors. Genomic analysis has identified numerous virulence genes in C. jejuni related to adherence, colonization, and invasion . The energy provided by ATP synthase activity supports the expression and function of these virulence determinants during host colonization.

Stress Response and Persistence: Host-associated stresses (pH changes, immune responses, antimicrobial peptides) require energy-dependent responses. ATP synthase activity provides the energy needed for stress response systems, contributing to C. jejuni persistence in the host. The ability to maintain membrane potential and ATP production under stress conditions depends on the proper function of all ATP synthase components, including atpB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.