Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

PlsY is an enzyme responsible for transferring acyl groups from acyl-phosphate to glycerol-3-phosphate, initiating phospholipid biosynthesis in bacterial membranes . In C. jejuni, this enzyme is encoded by the plsY gene (UniProt ID: A8FKE6) and plays a role in membrane integrity and virulence .

Key Features:

PropertyDescription
Gene NameplsY
SynonymsC8J_0334; GPAT; LPA synthase
Protein LengthFull-length (1–202 amino acids)
Expression SystemEscherichia coli with N-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; avoid repeated freeze-thaw cycles

Production and Purification

Recombinant PlsY is produced in E. coli and purified using affinity chromatography. Key protocols include:

  • Reconstitution: Lyophilized protein is reconstituted in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Stability: Glycerol (5–50%) is recommended for long-term storage .

Vaccine Development

PlsY is a candidate for subunit vaccines due to its surface exposure in C. jejuni . Studies on homologous proteins (e.g., PEB1, PorA) demonstrate that recombinant outer membrane proteins elicit protective immune responses in murine models .

Functional Studies

  • Membrane Biogenesis: PlsY’s role in phospholipid synthesis makes it a target for antimicrobial drug discovery .

  • Virulence Modulation: Knockout studies of similar acyltransferases in C. jejuni reveal impacts on host colonization and stress adaptation .

Comparative Analysis with Other C. jejuni Proteins

ProteinFunctionRole in VirulenceRecombinant Use Case
PlsYPhospholipid biosynthesisMembrane integrityVaccine antigen
PEB1AdhesionHost cell invasionSubunit vaccine
PorAOuter membrane channelNutrient uptakeImmunogen
Cj-RNRRNA degradationStress response, adhesionVirulence studies

Challenges and Future Directions

  • Immunogenicity Optimization: Improving PlsY’s stability in formulation buffers (e.g., trehalose-based) .

  • Functional Redundancy: C. jejuni possesses alternative lipid biosynthesis pathways, necessitating combinatorial targeting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; C8J_0334; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Target Names
plsY
Target Protein Sequence
MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVLRVVKEKNPKLAKKLA IATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIYLLFEGGKGIATGAGAM IVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIFNYDLEIHTHAPVFIIAF IIVYKHLPNIKRLIFKEECKVI
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links

KEGG: cju:C8J_0334

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Campylobacter jejuni metabolism?

Glycerol-3-phosphate acyltransferase (GPAT) serves as the rate-limiting enzyme in the de novo pathway of glycerolipid synthesis in C. jejuni, catalyzing the conversion of glycerol-3-phosphate and long-chain acyl-CoA to lysophosphatidic acid. This reaction represents the first committed step in phospholipid and triacylglycerol synthesis, making it critical for membrane formation and energy storage. In most tissues, triacylglycerol (TAG) is produced through the glycerol phosphate pathway, with GPAT enzymes exhibiting the lowest specific activity in the pathway, thereby functioning as rate-limiting catalysts . While mammalian systems have four characterized GPAT isoforms classified into mitochondrial (GPAT1, GPAT2) and endoplasmic reticulum (GPAT3, GPAT4) groups, the C. jejuni plsY represents a bacterial variant with distinct evolutionary and functional characteristics.

How does the serotype O:6 classification relate to the capsular polysaccharide structure of C. jejuni?

The serotype O:6 classification in C. jejuni is part of the Penner serotyping scheme, which is primarily based on the polysaccharide capsule (CPS) structure. The CPS of C. jejuni functions as the major serodeterminant in this classification system. Currently, 47 Penner serotypes of C. jejuni have been identified, with 22 of these falling into complexes of related serotypes . The O:6 serotype designation indicates a specific capsular polysaccharide composition that can be identified through serological methods or, more recently, through molecular techniques such as multiplex PCR. DNA sequence analysis of capsule loci has revealed their mosaic nature, suggesting gene reassortment through horizontal transfer events, while simultaneously demonstrating high conservation of genes within Penner complexes . This genetic architecture explains the serological cross-reactivity observed between related serotypes within complexes.

What is the significance of using recombinant expression systems for studying C. jejuni plsY?

Recombinant expression systems provide several methodological advantages for studying C. jejuni plsY:

  • Protein purification efficiency: Recombinant systems allow for the addition of affinity tags (e.g., His-tags) that facilitate purification using methods such as immobilized metal affinity chromatography.

  • Expression control: Inducible promoters permit precise regulation of protein production, essential for potentially toxic bacterial enzymes.

  • Structural and functional analysis: Purified recombinant proteins enable detailed biochemical characterization, crystallography studies, and enzyme kinetics experiments.

  • Mutagenesis studies: Recombinant systems facilitate the generation of site-directed mutants to probe structure-function relationships.

A typical recombinant expression protocol involves amplifying the target gene using PCR with appropriate restriction sites (e.g., NdeI and BamHI), followed by cloning into expression vectors like pET19b, similar to approaches used for other C. jejuni enzymes . For example, the following table outlines a standard cloning strategy:

Cloning StageComponentsTechnical Details
Gene AmplificationGenomic DNA, specific primers, high-fidelity polymerase1944 bp product for comparable C. jejuni genes
Initial CloningPCR product, pGEM-T vectorIntermediate cloning step
Expression Vector ConstructionpET19b vector, restriction enzymes (NdeI, BamHI)Results in N-terminal His-tagged construct
VerificationDNA sequencingConfirms correct insertion and sequence integrity

How do glycoconjugates in C. jejuni serotype O:6 influence host-pathogen interactions, and what methodologies can assess their role in infection models?

C. jejuni glycoconjugates play multifaceted roles in host-pathogen interactions, with potential variation between serotypes including O:6. These structures are involved in:

  • Initial adherence: Mannose and sialic acid residues mediate initial host-pathogen interactions following environmental exposure.

  • Prolonged colonization: Fucose and galactose-based interactions appear necessary for sustained colonization .

  • Immune evasion: Surface glycans can mimic host structures, particularly gangliosides, providing protection against host immune responses.

  • Decoy receptor interactions: Host intestinal mucins can act as decoy receptors for C. jejuni adhesins, demonstrating the complex interplay between host glycoproteins and bacterial surface molecules .

Methodological approaches to assess these interactions include:

  • Glycan array analysis: This technique has demonstrated that C. jejuni interacts with a wide range of host glycoconjugates, allowing for high-throughput screening of binding specificities .

  • Cell adhesion/invasion assays: Quantitative measurement of bacterial adherence to and invasion of cultured epithelial cells under controlled conditions.

  • Animal colonization models: Chick colonization models can assess the contribution of specific glycoconjugates to in vivo persistence.

  • Temperature-responsive expression analysis: Comparing glycoconjugate profiles at different temperatures (avian host temperature vs. mammalian host temperature) to identify host-adapted expression patterns .

What are the current methodological challenges in characterizing the enzymatic activity of C. jejuni plsY, and how can these be addressed?

Characterizing C. jejuni plsY enzymatic activity presents several technical challenges:

  • Enzyme stability: GPATs often demonstrate reduced stability in vitro, particularly when removed from their native membrane environment.

  • Substrate availability: Natural acyl-CoA substrates can be expensive and unstable during long incubations.

  • Product analysis: Lysophosphatidic acid products require specialized lipid analysis techniques.

  • Membrane-associated enzyme assays: As a membrane-associated enzyme, activity assays must account for hydrophobic interactions.

Methodological solutions include:

  • Detergent optimization: Systematic screening of detergents (e.g., CHAPS, Triton X-100) at varying concentrations to maintain enzyme solubility while preserving activity.

  • Radioactive assays: Using radiolabeled substrates (^14C-glycerol-3-phosphate or ^14C-fatty acyl-CoA) to detect product formation with high sensitivity.

  • LC-MS/MS approaches: Liquid chromatography coupled with tandem mass spectrometry enables detailed characterization of reaction products.

  • Nanodiscs or liposome reconstitution: Incorporating purified enzyme into artificial lipid bilayers to better mimic native conditions.

  • Temperature-activity profiling: Determining the temperature optimum across a range (e.g., 25-42°C) to account for C. jejuni's adaptation to both environmental and host conditions.

How does the LOS biosynthesis pathway intersect with glycerolipid metabolism in C. jejuni, and what experimental approaches can elucidate these interactions?

The lipooligosaccharide (LOS) biosynthesis and glycerolipid metabolism pathways in C. jejuni intersect at several points, with significant implications for membrane biogenesis and host interaction:

  • Shared precursors: Both pathways utilize activated sugar nucleotides and fatty acyl donors.

  • Membrane localization: Enzymes from both pathways are often co-localized in the bacterial membrane.

  • Regulatory crosstalk: Environmental conditions can simultaneously affect both pathways.

Experimental approaches to investigate these interactions include:

  • Metabolic labeling studies: Using isotope-labeled precursors to trace metabolic flux between pathways.

  • Conditional mutants: Creating temperature-sensitive or inducible mutants in one pathway to observe effects on the other.

  • Lipidomic profiling: Comprehensive mass spectrometry analysis of lipid composition under varying conditions.

  • Protein-protein interaction studies: Co-immunoprecipitation or bacterial two-hybrid assays to identify physical interactions between enzymes from different pathways.

  • Temperature-responsive regulation analysis: Examining expression patterns at different temperatures can reveal pathway coordination, as seen in LOS sialylation changes between avian (42°C) and mammalian (37°C) host temperatures, where sialylation levels can shift from 50% to 90% .

What is the relationship between C. jejuni plsY activity and bacterial virulence, and how can this be experimentally determined?

The relationship between C. jejuni plsY activity and virulence likely involves several mechanisms:

  • Membrane integrity: As a key enzyme in phospholipid biosynthesis, plsY affects membrane composition and potentially resistance to host defenses.

  • Energy storage: Altered triacylglycerol synthesis may impact bacterial survival under stress conditions.

  • Signaling molecule production: Lysophosphatidic acid and derivatives may serve as bacterial signaling molecules.

  • Interaction with other virulence factors: Membrane composition affects the insertion and function of other virulence factors.

Experimental approaches to determine these relationships include:

  • Targeted gene disruption: Creating plsY knockout or knockdown strains, though complete deletion may be lethal, necessitating conditional approaches.

  • Site-directed mutagenesis: Introducing specific mutations that alter activity without completely abolishing it.

  • Virulence model testing: Assessing mutant strains in established models:

    • Adhesion/invasion assays using human intestinal epithelial cell lines

    • Galleria mellonella infection model

    • Animal colonization models (chick colonization)

  • Complementation studies: Restoring wild-type phenotype by expressing functional plsY in trans.

  • Enzymatic activity correlation: Correlating measured enzymatic activity levels with virulence phenotypes across clinical isolates.

This approach is supported by similar studies of other C. jejuni enzymes like RNase R, which has been shown to be important for adhesion and invasion of eukaryotic cells .

What are the critical parameters for optimizing recombinant expression of C. jejuni plsY?

Optimizing recombinant expression of C. jejuni plsY requires careful consideration of several parameters:

  • Expression system selection: While E. coli is commonly used, alternative systems like C. jejuni itself or other Gram-negative hosts may provide better folding environments.

  • Vector and promoter choice:

    • Strong inducible promoters (T7, tac) for maximum yield

    • Weaker promoters if toxicity is observed

    • Vectors with appropriate copy number

  • Strain selection:

    • BL21(DE3) for standard expression

    • C41/C43(DE3) for potentially toxic membrane proteins

    • Rosetta strains if C. jejuni codon bias is problematic

  • Induction conditions:

    • Temperature: Often lowered to 16-25°C for membrane proteins

    • Inducer concentration: Typically 0.1-1.0 mM IPTG, but may require optimization

    • Induction timing: Usually at mid-log phase (OD600 0.6-0.8)

    • Duration: 4 hours to overnight

  • Solubilization strategies:

    • Detergent screening (CHAPS, DDM, Triton X-100)

    • Fusion partners (MBP, SUMO, TrxA)

    • Co-expression with chaperones

The following table provides a systematic approach to expression optimization:

ParameterVariables to TestMonitoring Method
Temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blot
Inducer (IPTG)0.1 mM, 0.5 mM, 1.0 mMSDS-PAGE, Western blot
Induction time4h, 6h, 16hSDS-PAGE, activity assay
DetergentsCHAPS (0.5-1%), DDM (0.05-0.1%), Triton X-100 (0.1-1%)Solubility test, activity assay
MediumLB, TB, 2YT, M9 minimalCell density, protein yield

How can researchers design specific primers for amplifying and characterizing the plsY gene across different C. jejuni serotypes?

Designing specific primers for plsY amplification across C. jejuni serotypes requires a strategic approach:

  • Sequence alignment analysis:

    • Collect and align all available plsY sequences from different C. jejuni serotypes

    • Identify conserved regions flanking the gene for universal primers

    • Identify variable regions for serotype-specific primers

  • Primer design considerations:

    • Length: 18-30 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with minimal difference between primer pairs

    • Avoid secondary structures and self-complementarity

    • Add restriction sites with additional 3-6 nucleotide overhangs if cloning is planned

  • Validation strategy:

    • In silico specificity testing against genomic databases

    • Gradient PCR to optimize annealing temperature

    • Testing against a panel of different serotypes

  • Control design:

    • Include primers for a C. jejuni housekeeping gene (e.g., 16S rRNA) as positive controls

    • Design internal primers for nested PCR approaches

For multiplex PCR approaches, similar to those developed for capsule typing , design considerations should account for:

  • Amplicon size differences for clear resolution on gels

  • Compatible annealing temperatures

  • Balanced primer concentrations to avoid competition

How should researchers interpret contradictory results between in vitro enzymatic activities and in vivo phenotypes of C. jejuni plsY mutants?

When confronted with contradictions between in vitro enzymatic measurements and in vivo phenotypes of C. jejuni plsY mutants, researchers should consider several factors:

  • Physiological context differences:

    • In vitro assays lack the complex cellular environment

    • Buffer conditions may not reflect intracellular conditions

    • Temperature, pH, and ionic strength variations between test tube and bacterial cell

  • Compensatory mechanisms:

    • Alternative enzymatic pathways may be upregulated in vivo

    • Metabolic rewiring can occur in response to enzyme deficiencies

    • Post-translational modifications may differ between systems

  • Methodological considerations:

    • Substrate concentrations in vitro often exceed physiological levels

    • Detergents used for enzyme solubilization may alter kinetic properties

    • Recombinant tags might affect activity or protein interactions

  • Analytical approach:

    • Perform transcriptomic and proteomic analyses of mutants

    • Measure metabolite concentrations using metabolomics

    • Create double mutants to identify compensatory pathways

    • Implement conditional expression systems to titrate enzyme levels

  • Resolution strategies:

    • Develop cell-free extract assays that better mimic cellular conditions

    • Create point mutations rather than null mutants

    • Implement time-resolved studies to capture adaptation processes

Similar approaches have been successful in resolving contradictions in studies of other C. jejuni enzymes, such as those involved in LOS biosynthesis where environmental conditions significantly affect enzymatic activity patterns .

What bioinformatic approaches can help predict functional domains and catalytic mechanisms of C. jejuni plsY when compared to homologous enzymes from other species?

Comprehensive bioinformatic analysis of C. jejuni plsY should employ multiple approaches:

  • Sequence-based analyses:

    • Multiple sequence alignment with homologs from diverse species

    • Identification of conserved residues across bacterial phyla

    • Phylogenetic tree construction to understand evolutionary relationships

    • Domain prediction using tools like PFAM, InterPro, and SMART

  • Structure prediction methods:

    • Homology modeling based on crystal structures of related GPATs

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to predict conformational flexibilities

    • Protein-substrate docking to identify binding pockets

  • Functional prediction approaches:

    • Active site prediction based on conserved catalytic motifs

    • Substrate binding site analysis

    • Protein-protein interaction prediction

    • Transmembrane topology prediction using TMHMM or Phobius

  • Integrative analysis:

    • Correlation of genetic variations with enzymatic activities

    • Mapping of predicted functional regions to 3D structure

    • Comparison with mammalian GPAT isoforms to identify bacterial-specific features

The following table illustrates a comparison of key predicted features between bacterial and mammalian GPATs:

FeatureC. jejuni plsYMammalian GPATsSignificance
Transmembrane domains1-2 predicted3-4 (GPAT1/2), 2-3 (GPAT3/4)Influences membrane association
Active site motifsH(X)4D/EH(X)4DCatalytic residues
Substrate binding pocketSmaller, more specificLarger, accommodates diverse substratesSubstrate specificity
Regulatory domainsMinimalExtended N/C-terminal regionsRegulatory control

How can researchers differentiate between direct effects of plsY manipulation and indirect metabolic consequences when analyzing phenotypes in C. jejuni mutant strains?

Differentiating direct effects of plsY manipulation from indirect metabolic consequences requires sophisticated experimental designs:

  • Temporal analysis:

    • Immediate vs. delayed phenotypic changes after induction/repression

    • Time-course metabolomic profiling to identify primary vs. secondary metabolic shifts

    • Pulse-chase labeling to track metabolic flux

  • Genetic approaches:

    • Complementation with wild-type vs. catalytically inactive variants

    • Point mutations affecting specific functions rather than complete gene knockouts

    • Suppressor mutation analysis to identify compensatory pathways

  • Metabolic network analysis:

    • Comprehensive metabolomic profiling to identify affected pathways

    • Isotope-labeled precursor studies to track altered metabolic flux

    • Integration with transcriptomic data to identify regulatory responses

  • Targeted biochemical assays:

    • Direct measurement of lysophosphatidic acid and phospholipid levels

    • Analysis of membrane phospholipid composition

    • Enzyme activity measurements for related metabolic pathways

  • Synthetic biology approaches:

    • Controlled expression systems to titrate enzyme levels

    • Orthogonal enzyme substitution (e.g., plsY from non-related organism)

    • Creation of minimal synthetic pathways in heterologous hosts

These approaches can be particularly valuable when examining complex phenotypes like those observed with RNase R, where gene deletion affected multiple cellular processes including adhesion and invasion capabilities .

How can knowledge of C. jejuni plsY structure and function contribute to the development of novel antimicrobial strategies?

Understanding C. jejuni plsY structure and function offers several potential avenues for antimicrobial development:

  • Structure-based drug design:

    • Identification of catalytic pocket characteristics distinct from mammalian homologs

    • Virtual screening of compound libraries against structural models

    • Fragment-based drug discovery targeting specific binding sites

    • Design of transition-state analogs as competitive inhibitors

  • Pathway-specific inhibition strategies:

    • Targeting rate-limiting steps in phospholipid biosynthesis

    • Development of acyl-CoA or glycerol-3-phosphate analogs as substrate competitors

    • Allosteric inhibitors affecting enzyme regulation

    • Covalent inhibitors targeting conserved catalytic residues

  • Experimental screening approaches:

    • High-throughput enzymatic assays for inhibitor identification

    • Whole-cell screening with reporter systems linked to membrane integrity

    • Phenotypic screening focused on membrane-related functions

    • Resistance development monitoring to identify potential escape mechanisms

  • Combination therapy design:

    • Synergistic targeting with other membrane-disrupting agents

    • Inhibition of multiple points in the phospholipid biosynthesis pathway

    • Coupling with efflux pump inhibitors to increase intracellular concentration

The significance of targeting plsY is highlighted by previous studies demonstrating that enzymes in similar pathways, such as RNase R, play crucial roles in C. jejuni pathogenesis, particularly in adhesion and invasion of host cells . As noted in those studies, targeting such enzymes could potentially reduce infection by this foodborne pathogen.

What methodological considerations are important when designing experiments to investigate the role of plsY in C. jejuni adaptation to different environmental stresses?

Investigating plsY's role in stress adaptation requires careful experimental design:

  • Stress condition parameters:

    • Temperature shifts (4°C for cold stress, 42-45°C for heat stress)

    • Oxidative stress (hydrogen peroxide, superoxide generators)

    • Acid stress (pH 4.5-5.5)

    • Bile salt exposure (0.1-1% bile salts)

    • Osmotic stress (salt concentration variations)

  • Expression analysis approaches:

    • qRT-PCR for targeted gene expression analysis

    • RNA-Seq for global transcriptional response

    • Proteomics to assess protein levels and post-translational modifications

    • Reporter gene fusions to monitor promoter activity

  • Phenotypic characterization:

    • Growth curve analysis under stress conditions

    • Survival rate determination

    • Morphological examination (microscopy)

    • Membrane integrity assessment (fluorescent dyes, leakage assays)

    • Lipidome analysis to detect composition changes

  • Genetic manipulation strategies:

    • Inducible expression systems for controlled plsY levels

    • Point mutations affecting specific enzymatic properties

    • Complementation with orthologs from stress-resistant bacteria

    • Promoter swapping to alter regulation

  • Comparative analysis:

    • Multiple C. jejuni strains with different stress tolerances

    • Comparison with related Campylobacter species

    • Analysis of clinical vs. environmental isolates

This multifaceted approach would be similar to studies examining temperature-responsive changes in C. jejuni LOS sialylation, where significantly different patterns were observed between avian host temperatures (42°C) and mammalian host temperatures (37°C) .

What are the most promising approaches for elucidating the three-dimensional structure of C. jejuni plsY, and what technical challenges must be overcome?

Elucidating the three-dimensional structure of C. jejuni plsY presents specific challenges and opportunities:

  • X-ray crystallography approaches:

    • Membrane protein crystallization techniques (lipidic cubic phase, bicelles)

    • Surface engineering to improve crystal contacts (T4 lysozyme fusion)

    • Co-crystallization with substrates, products, or inhibitors

    • Synchrotron radiation for high-resolution data collection

  • Cryo-electron microscopy strategies:

    • Single-particle analysis of detergent-solubilized protein

    • Reconstitution into nanodiscs for structure determination in lipid environment

    • Time-resolved studies to capture conformational changes

    • Subtomogram averaging for in situ structural analysis

  • NMR spectroscopy applications:

    • Solution NMR of detergent-solubilized domains

    • Solid-state NMR of reconstituted protein in membranes

    • Selective isotope labeling to study specific regions

    • Paramagnetic relaxation enhancement to map distances

  • Technical challenges to overcome:

    • Protein stability during purification and crystallization

    • Micelle/detergent interference with structural techniques

    • Conformational heterogeneity

    • Expression levels sufficient for structural studies

    • Phase determination for crystallographic approaches

  • Integrative structural biology:

    • Combining multiple structural techniques (X-ray, EM, NMR)

    • Computational modeling and refinement

    • Cross-linking mass spectrometry for distance constraints

    • Molecular dynamics simulations to study dynamics

Similar structural biology approaches have been successful with other challenging bacterial membrane proteins and would provide invaluable insights into the catalytic mechanism and potential inhibitor binding sites of C. jejuni plsY.

How might systems biology approaches integrate plsY function with global metabolic networks in C. jejuni to better understand its role in pathogenesis?

Systems biology approaches offer powerful frameworks for understanding plsY's role within C. jejuni's metabolic network:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation analysis between plsY expression and global metabolic states

    • Temporal profiling during infection processes

    • Integration of genomic variation with phenotypic differences

  • Metabolic modeling:

    • Genome-scale metabolic reconstruction incorporating plsY reactions

    • Flux balance analysis to predict metabolic consequences of plsY modulation

    • Metabolic control analysis to quantify pathway flux control

    • In silico prediction of essential partner enzymes

  • Network analysis approaches:

    • Protein-protein interaction network construction

    • Identification of plsY-centered regulatory networks

    • Pathway enrichment analysis in different physiological states

    • Network perturbation modeling to predict system responses

  • Experimental validation strategies:

    • CRISPR interference for titratable gene repression

    • Metabolic flux analysis using stable isotope labeling

    • High-throughput phenotyping across environmental conditions

    • Synthetic lethality screening to identify genetic interactions

  • Host-pathogen interaction modeling:

    • Dual RNA-Seq during infection to capture host and pathogen responses

    • Agent-based modeling of infection dynamics

    • Integration of host metabolic responses with bacterial adaptation

    • Prediction of metabolic niche exploitation during infection

These approaches would build upon existing knowledge of C. jejuni glycoconjugate functions in host-pathogen interactions and the roles of other enzymes like RNase R in virulence , creating a comprehensive understanding of how membrane lipid metabolism interfaces with pathogenesis mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.