Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Key Features

ParameterDetailsSource
Strain OriginC. jejuni subsp. jejuni serotype O:6 (81116/NCTC 11828)
Protein SpanAmino acids 1–156
Source OrganismsExpressed in E. coli, yeast, baculovirus, or mammalian cells
Target OrganismCampylobacter jejuni
ApplicationsVaccine development, antigenic studies, and virulence factor research
Purity/StorageHigh-purity formulations; stored at -20°C or -80°C for long-term stability

Function: lspA facilitates the cleavage of N-terminal signal peptides from precursor lipoproteins, enabling their proper localization to bacterial membranes. This process is critical for the assembly of virulence factors, such as adhesins and secretion system components .

Role in C. jejuni Pathogenesis

Lipoproteins are central to C. jejuni’s ability to colonize hosts and evade immune responses. While lspA itself is not directly implicated in virulence, its enzymatic activity enables the maturation of key lipoproteins, including:

  • JlpA: A surface-exposed lipoprotein adhesin that binds host epithelial cells and triggers inflammatory responses .

  • FspA: A secreted protein linked to apoptosis induction in host cells .

  • MAPA: A membrane-associated lipoprotein used for serotyping and species identification .

The structural diversity of lspA across C. jejuni strains (e.g., serotype O:6) may influence the efficiency of lipoprotein processing, thereby modulating pathogenicity .

Vaccine Development

lspA is being explored as a vaccine candidate due to its antigenic properties. Recombinant lspA proteins are used to stimulate immune responses targeting C. jejuni’s membrane components. Key advantages include:

  • Conservation: lspA is highly conserved across C. jejuni strains, enhancing cross-protection .

  • Safety: As a recombinant protein, it avoids the risks associated with live or attenuated vaccines .

Gaps in Knowledge

  • Mechanistic Insights: Limited studies directly link lspA activity to C. jejuni’s colonization or immune evasion.

  • Strain Variability: Differences in lspA expression or efficiency across persistent strains (e.g., REPDBR01) remain unexplored .

Research Priorities

  1. Structural Studies: Elucidate lspA’s enzymatic mechanism and substrate specificity.

  2. Vaccine Optimization: Evaluate lspA’s efficacy in animal models, particularly in poultry (primary reservoir) .

  3. Antigenic Profiling: Identify conserved epitopes for broad-spectrum vaccine design .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lspA; C8J_0337; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Target Names
lspA
Target Protein Sequence
MAKTFKFIFYFWGAFVLVFVLDQWVKSLTLAGLRWQSEYLDLTYALNTGVAFSMLSFLEH NLKYLHLALIVVLFIYLFWQKTLLKTHSIAFGMMLGAGVSNLLDRFIHGGVVDMFFWHKW FNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: cju:C8J_0337

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of LspA in Campylobacter jejuni?

LspA (lipoprotein signal peptidase) in C. jejuni functions as a signal peptidase II that removes signal peptides from lipoproteins during post-translational processing. These lipoproteins are synthesized with signal peptides that secure them to the cytoplasmic membrane, with the lipoprotein domain positioned in the periplasm or outside the cell . The critical function of LspA is to cleave these signal peptides, allowing proper localization and function of mature lipoproteins. This processing is essential for bacterial physiology since lipoproteins constitute approximately 2-3% of bacterial genomes and play vital roles in cell envelope structure, signal transduction, transport, and virulence .

Mechanistically, LspA belongs to the aspartyl peptidase family, as determined through mutagenesis studies in related bacterial species . Unlike other peptidases, LspA specifically recognizes and cleaves the signal peptides of lipoproteins after they have been lipid-modified at their N-terminal cysteine residue, making it a highly specialized enzyme in bacterial protein processing machinery.

How does C. jejuni LspA structure compare to LspA from other bacterial species?

While the crystal structure of C. jejuni LspA has not been directly reported in the provided materials, significant insights can be drawn from the related structure of Pseudomonas aeruginosa LspA, resolved at 2.8 Å resolution . Based on evolutionary conservation among bacterial signal peptidases, C. jejuni LspA likely shares several structural characteristics:

  • Multiple transmembrane domains anchoring the protein in the cytoplasmic membrane

  • A catalytic site containing conserved aspartate residues essential for peptidase activity

  • A binding pocket that accommodates the lipoprotein signal peptide

  • Structural features that determine specificity for lipid-modified substrates

These structural elements likely show conservation across bacterial species, with variations in specific regions that may reflect differences in substrate specificity between pathogens. The structural similarity would also explain why globomycin, which inhibits P. aeruginosa LspA through molecular mimicry by acting as a non-cleavable peptide that sterically blocks the active site, might have similar effects on C. jejuni LspA .

What are the optimal conditions for recombinant expression of C. jejuni LspA?

Based on approaches used for similar bacterial proteins, recombinant expression of C. jejuni LspA requires careful optimization due to its multiple transmembrane domains. The recommended methodology includes:

  • Vector selection: pET-based expression systems with N-terminal or C-terminal fusion tags (His6, MBP, or SUMO) to improve solubility and facilitate purification

  • Expression host: E. coli strains designed for membrane protein expression such as C41(DE3) or C43(DE3)

  • Culture conditions: Growth at lower temperatures (16-20°C) after induction to slow protein production and improve folding

  • Induction protocol: Lower IPTG concentrations (0.1-0.5 mM) and extended expression times (16-24 hours)

  • Media supplementation: Addition of glycerol (0.5-1%) and specific divalent cations to stabilize membrane proteins

For methodology validation, similar approaches have been successfully employed for the expression of other membrane-associated proteins from C. jejuni, as evidenced by studies on the CmeABC multidrug efflux pump . When expressing recombinant transmembrane proteins like LspA, it's crucial to verify protein integrity using both SDS-PAGE analysis and functional assays to ensure proper folding.

What purification strategies yield functional C. jejuni LspA for structural and enzymatic studies?

Purifying functional LspA requires specialized approaches for membrane proteins:

Table 1: Recommended Purification Protocol for C. jejuni LspA

StageMethodBuffer CompositionCritical Parameters
Cell LysisMechanical disruption50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsAvoid excessive heating
Membrane ExtractionUltracentrifugationSame as lysis buffer100,000×g, 1 hour, 4°C
SolubilizationDetergent treatmentLysis buffer + 1% DDM or LDAO2-3 hours, gentle agitation
Affinity ChromatographyIMAC (for His-tagged protein)Solubilization buffer with 0.05% detergent + imidazole gradientFlow rate ≤0.5 ml/min
Size ExclusionGel filtration25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 0.03% DDMAssess oligomeric state
ValidationSDS-PAGE and Western blot-Use anti-LspA antibodies

This purification approach maintains the native fold of LspA by ensuring it remains in a membrane-mimetic environment through the use of appropriate detergents. The approach is similar to methods used for other C. jejuni membrane proteins, where detergent selection has proven critical for maintaining functional activity . Activity of the purified LspA should be verified through peptidase assays using synthetic lipoprotein substrates.

How can researchers assess the enzymatic activity of recombinant C. jejuni LspA in vitro?

The enzymatic activity of purified recombinant C. jejuni LspA can be evaluated through several complementary approaches:

  • Fluorogenic peptide substrate assay: Using synthetic peptides containing the recognition sequence of LspA linked to a fluorophore-quencher pair. Cleavage by LspA separates the fluorophore from the quencher, resulting in increased fluorescence that can be monitored in real-time.

  • Mass spectrometry-based analysis: Incubating LspA with synthetic lipoprotein substrates and analyzing the cleavage products by LC-MS/MS to identify precise cleavage sites and kinetics.

  • Inhibition studies: Assessing activity in the presence of known LspA inhibitors like globomycin, which acts as a non-cleavable peptide that sterically blocks the active site .

  • Mutational analysis: Creating site-directed mutants of predicted catalytic residues (typically conserved aspartates) to confirm their importance in the enzymatic mechanism, similar to the approach used to identify LspA as an aspartyl peptidase in P. aeruginosa .

For accurate activity assessment, it's critical to maintain LspA in a membrane-mimetic environment using appropriate detergents or lipid nanodiscs, as the protein's natural environment is the bacterial membrane.

What is the role of LspA in C. jejuni pathogenesis and host-pathogen interactions?

LspA plays a significant role in C. jejuni pathogenesis through several mechanisms:

  • Lipoprotein processing: LspA processes lipoproteins that are critical for bacterial cell envelope integrity and function. Impaired processing can compromise membrane structure and stability .

  • Virulence factor maturation: Many bacterial virulence factors are lipoproteins that require proper processing by LspA for full activity. These include adhesins, immune evasion factors, and nutrient acquisition systems.

  • Immune recognition modulation: Properly processed lipoproteins can trigger host pattern recognition receptors, including TLR2, influencing inflammatory responses. In C. jejuni, this may contribute to the acute symptoms of gastroenteritis, including diarrhea, abdominal pain, and fever .

  • Antibiotic resistance: LspA processes lipoproteins involved in multidrug efflux systems like CmeABC, which contribute to C. jejuni's ability to resist antimicrobials .

The importance of LspA in C. jejuni pathogenesis is supported by findings that this pathogen causes significant morbidity worldwide, with more than 800,000 cases of campylobacteriosis domestically acquired each year in the United States alone, resulting in an annual financial burden of US$6.9 million . Furthermore, C. jejuni infections are associated with post-infectious intestinal disorders, including flares in patients with inflammatory bowel disease and post-infectious irritable bowel syndrome .

How can CRISPR-Cas9 genome editing be applied to study LspA function in C. jejuni?

CRISPR-Cas9 genome editing offers powerful approaches for studying LspA function in C. jejuni:

Methodological workflow for CRISPR-Cas9 editing of C. jejuni lspA:

  • sgRNA design: Target sequences within the lspA gene that minimize off-target effects, preferably targeting the catalytic domain.

  • Delivery system: Develop a C. jejuni-compatible CRISPR-Cas9 delivery system, potentially using shuttle vectors with campylobacter-specific origin of replication.

  • Repair template design: Create homology-directed repair templates for:

    • Catalytic site mutations to study enzymatic mechanism

    • Domain deletions to assess structural requirements

    • Fluorescent protein fusions to track localization

    • Conditional expression systems to study essentiality

  • Phenotypic analysis:

    • Growth curve analysis under various stress conditions

    • Membrane integrity assessments

    • Lipoprotein processing verification by mass spectrometry

    • Pathogenesis studies in relevant in vitro and in vivo models

This approach offers advantages over traditional mutagenesis methods by enabling precise genetic modifications without polar effects on downstream genes. For validating essential genes like lspA, conditional approaches such as CRISPRi (CRISPR interference) may be preferable, allowing reversible downregulation rather than complete knockout.

The methodology can be adapted from approaches used for genetic manipulation of other C. jejuni genes, such as those described for studying the CmeABC multidrug efflux pump or flagellar expression systems .

What structural biology techniques are most suitable for resolving C. jejuni LspA architecture and substrate interactions?

Multiple complementary structural biology techniques can be applied to elucidate C. jejuni LspA architecture:

  • X-ray crystallography: The success with P. aeruginosa LspA suggests this approach is viable for C. jejuni LspA . Key considerations include:

    • Lipid cubic phase crystallization for membrane proteins

    • Use of antibody fragments to increase soluble surface area

    • Co-crystallization with inhibitors like globomycin to stabilize structure

  • Cryo-electron microscopy (cryo-EM): Particularly useful for visualizing LspA in different conformational states:

    • Single-particle analysis for high-resolution structure

    • Classification approaches to identify substrate-bound states

    • Visualization in lipid nanodiscs to mimic native environment

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map dynamics and substrate interactions:

    • Identify regions with altered solvent accessibility upon substrate binding

    • Map conformational changes during catalytic cycle

    • Detect inhibitor binding sites

  • Molecular dynamics simulations: To model LspA within the membrane environment:

    • Simulate substrate approach and binding

    • Model conformational changes during catalysis

    • Predict effects of mutations on structure and function

A comprehensive structural characterization would integrate data from these complementary techniques to develop a complete model of how LspA recognizes and processes lipoprotein substrates within the membrane environment, similar to the approach used for understanding the structural basis of P. aeruginosa LspA action and inhibition by globomycin .

How does inhibition of C. jejuni LspA affect bacterial survival in different host environments?

Inhibition of C. jejuni LspA likely has profound effects on bacterial survival across various host environments, though responses may differ based on specific conditions:

In the human gastrointestinal tract:
LspA inhibition would compromise processing of lipoproteins critical for membrane integrity and function. This would likely reduce C. jejuni's ability to survive the harsh conditions of the human GI tract, including acid exposure, bile salts, and antimicrobial peptides. Since C. jejuni is a leading cause of bacterial gastroenteritis worldwide, with symptoms including severe abdominal cramp and watery diarrhea , LspA inhibition could potentially attenuate virulence.

In animal reservoirs:
C. jejuni is a commensal bacterium in the gastrointestinal tract of food-producing animals such as poultry and cattle . In these natural reservoirs, LspA inhibition might:

  • Reduce colonization efficiency

  • Alter competitive fitness against other microbiota members

  • Decrease persistence and shedding

During environmental transmission:
C. jejuni infection is commonly acquired through contaminated water, food, or milk . LspA inhibition could reduce environmental survival during transmission by compromising stress responses mediated by properly processed lipoproteins.

The differential effects of LspA inhibition across these environments make it an intriguing target for both basic research into bacterial adaptation and potential therapeutic development for reducing C. jejuni carriage and transmission.

What is the relationship between LspA function and C. jejuni's immunomodulatory effects?

C. jejuni LspA's function intersects with immunomodulation through several mechanisms:

  • Lipoprotein processing and TLR activation: Properly processed lipoproteins can stimulate host Toll-like receptors, particularly TLR2. In C. jejuni, this may contribute to the inflammatory response that leads to acute symptoms of gastroenteritis . LspA processes lipoproteins that may participate in this host-pathogen crosstalk.

  • Indirect effects on flagellin expression: C. jejuni employs multiple strategies to modulate host immunity, including through flagellin proteins. The flagellin-like protein FlaC has been shown to interact with TLR5 and possesses immunomodulatory properties . While LspA doesn't directly process flagellins (which are not lipoproteins), it may process lipoproteins involved in flagellar assembly or regulation.

  • Immune evasion systems: C. jejuni capsular polysaccharide (CPS) contributes significantly to immune system evasion . LspA may process lipoproteins involved in CPS biosynthesis or regulation, indirectly affecting this immune evasion mechanism.

  • Cross-tolerance induction: Some C. jejuni proteins induce cross-tolerance to subsequent exposure to bacterial ligands. For example, the flagellin-like protein FlaC decreased the responsiveness of chicken and human macrophage-like cells toward bacterial LPS, suggesting it mediates cross-tolerance . LspA-processed lipoproteins may participate in similar immunomodulatory pathways.

Understanding these relationships could inform approaches to vaccine development against C. jejuni, which remains a significant opportunity despite advances in population health, food security, improved sanitation, water quality, and the reduction of poverty .

What are the methodological considerations for validating C. jejuni LspA as an antimicrobial target?

Validating C. jejuni LspA as an antimicrobial target requires systematic methodological approaches:

  • Target essentiality assessment:

    • Conditional gene expression systems to demonstrate growth dependence

    • CRISPRi-based downregulation to establish minimum threshold for viability

    • Complementation studies with wild-type vs. catalytically inactive LspA

  • Inhibitor screening methodology:

    • Development of high-throughput enzymatic assays using fluorescent substrates

    • Whole-cell screening approaches with reporter systems for lipoprotein processing

    • Counter-screens against human peptidases to establish selectivity

  • Efficacy evaluation:

    • Determination of minimal inhibitory concentrations against diverse C. jejuni strains

    • Time-kill kinetics to determine bactericidal vs. bacteriostatic effects

    • Combination studies with existing antibiotics to identify synergistic effects

  • Resistance development assessment:

    • Serial passage experiments to evaluate resistance frequency

    • Whole genome sequencing of resistant isolates to identify mechanisms

    • Molecular modeling to predict resistance-conferring mutations

  • In vivo validation:

    • Pharmacokinetic and pharmacodynamic studies in animal models

    • Efficacy in colonization reduction in poultry models (reservoir hosts)

    • Efficacy in disease models of campylobacteriosis

The approach would build on insights from existing LspA inhibitors like globomycin, which has been shown to act as a noncleavable peptide that sterically blocks the active site , providing a structural template for rational drug design efforts targeting C. jejuni LspA.

How can structural data from C. jejuni LspA inform rational drug design approaches?

Structural data from C. jejuni LspA can guide rational drug design through several sophisticated approaches:

  • Structure-based inhibitor optimization:

    • Using crystal structures to identify binding pockets and interaction points

    • Molecular docking to screen virtual compound libraries

    • Fragment-based drug discovery focusing on the active site

    • Structure-activity relationship studies to improve potency and selectivity

  • Mechanism-based inhibitor design:

    • Development of transition state analogs based on catalytic mechanism

    • Covalent inhibitors targeting the aspartyl catalytic residues

    • Allosteric inhibitors targeting non-catalytic regulatory sites

    • Peptidomimetics that imitate the substrate but resist cleavage

  • Selectivity engineering:

    • Comparative analysis of bacterial vs. human aspartyl proteases

    • Targeting LspA-specific structural features absent in human enzymes

    • Exploiting differences in membrane environment of bacterial vs. human targets

  • Novel delivery strategies:

    • Designing inhibitors with optimal properties for penetrating C. jejuni's outer membrane

    • Developing prodrug approaches activated by C. jejuni-specific enzymes

    • Conjugation to C. jejuni-targeting moieties for selective delivery

The structural insights from P. aeruginosa LspA complexed with globomycin at 2.8 Å resolution provide an excellent starting point . This structure revealed that globomycin inhibits by acting as a noncleavable peptide that sterically blocks the active site—an example of molecular mimicry that could inspire design of C. jejuni LspA inhibitors with improved properties.

What are the current technical challenges in studying C. jejuni LspA and how can they be overcome?

Research on C. jejuni LspA faces several technical challenges:

  • Membrane protein expression and purification:

    • Challenge: Obtaining sufficient quantities of properly folded LspA

    • Solution: Screen multiple expression systems (bacterial, yeast, insect cells); optimize detergent conditions; use lipid nanodiscs for stabilization

  • Structural characterization:

    • Challenge: Obtaining crystals suitable for X-ray diffraction

    • Solution: Use lipidic cubic phase crystallization; employ fusion partners to increase soluble surface area; consider cryo-EM as alternative approach

  • Enzymatic assay development:

    • Challenge: Limited availability of natural lipoprotein substrates

    • Solution: Develop synthetic substrate mimics with fluorescent or colorimetric readouts; use mass spectrometry to detect product formation

  • Genetic manipulation of C. jejuni:

    • Challenge: Lower transformation efficiency compared to model organisms

    • Solution: Optimize electroporation protocols; use counter-selection markers; adapt CRISPR-Cas9 systems from related organisms

  • In vivo relevance assessment:

    • Challenge: Connecting biochemical findings to pathogenesis

    • Solution: Develop conditional expression systems; use animal models that recapitulate human infection; employ systems biology approaches

These methodological challenges can be addressed by adapting techniques that have proven successful for other difficult bacterial targets, such as those used to study the transcriptional regulation of the CmeABC multidrug efflux pump in C. jejuni .

How might C. jejuni LspA research intersect with emerging technologies in structural biology and drug discovery?

C. jejuni LspA research stands to benefit significantly from integration with emerging technologies:

  • AlphaFold and protein structure prediction:

    • Using AI-based structure prediction to model C. jejuni LspA and its interactions with substrates

    • Generating hypotheses about substrate specificity and inhibitor binding prior to experimental validation

    • Predicting effects of mutations on protein structure and function

  • Single-molecule enzymology:

    • Applying FRET-based approaches to monitor LspA conformational changes during catalysis

    • Using optical tweezers to study force-dependent aspects of membrane protein folding

    • Implementing single-molecule tracking to visualize LspA localization and dynamics in live bacteria

  • Microfluidics and organ-on-chip systems:

    • Developing gut-on-chip models to study C. jejuni-epithelial interactions under controlled conditions

    • Testing LspA inhibitors in physiologically relevant microenvironments

    • Measuring real-time effects of LspA modulation on host cell responses

  • High-throughput screening technologies:

    • Implementing acoustic dispensing for nanoliter-scale inhibitor screening

    • Using DNA-encoded libraries to screen millions of compounds simultaneously

    • Applying machine learning for hit prioritization and lead optimization

  • PROTAC and targeted protein degradation:

    • Designing bifunctional molecules that target LspA for degradation by bacterial proteases

    • Creating "molecular glues" that promote LspA interaction with inhibitory proteins

    • Developing bacteria-specific protein degradation systems

By leveraging these emerging technologies, researchers can overcome current limitations in C. jejuni LspA research and accelerate both fundamental understanding and therapeutic development. This interdisciplinary approach reflects the current trend toward integration of computational, structural, and cellular methods in modern infectious disease research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.