Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and Protein Details

  • Gene: lgt (CJJ81176_0431 in C. jejuni 81-176) .

  • Protein: Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) .

  • Amino Acid Sequence: Full-length (1-271 aa) :
    MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVRKFQLDINEKHLDSYFIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLIATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGVLRHPSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVLWGMSMGQILSFIMFITALLVYICIKFKKVNI

Expression System

  • Host: Escherichia coli .

  • Tag: N-terminal 10×His tag for purification .

Role in Lipoprotein Biosynthesis

  • Transfers diacylglyceryl groups to conserved cysteine residues in prolipoproteins, anchoring them to the membrane .

  • Essential for viability in E. coli; depletion causes cell lysis due to defective membranes .

Pathogenic Implications in C. jejuni

  • Lipoproteins modified by Lgt influence virulence traits, including:

    • Lipooligosaccharide (LOS) biosynthesis: Truncated LOS cores in lgtF mutants reduce host cell mimicry (e.g., ganglioside GM1/2) .

    • Antimicrobial resistance: Altered membrane integrity affects drug susceptibility .

Research Applications

Vaccine Development

  • Used as an antigen in vaccine candidates targeting C. jejuni-induced gastroenteritis .

Enzymatic Studies

  • Structural analysis (e.g., crystal structures of E. coli Lgt-PG complexes) informs inhibitor design .

  • Mutagenesis studies identify critical residues (e.g., R143A, E151A) for functional assays .

Comparative Analysis

Serotype-Specific Variations

FeatureSerotype O:6 (NCTC 11828) Serotype O:23/36 (A1VYC7)
UniProt IDA8FKJ4A1VYC7
Strain81116NCTC 11168
Key ApplicationsVaccine development, LOS biosynthesisStructural studies, lipoprotein modification

Challenges and Future Directions

  • Heterogeneity: Enzymatic activity varies under environmental stress (e.g., host niches) .

  • Therapeutic Targeting: Essentiality in C. jejuni makes Lgt a potential drug target, but structural conservation across bacteria requires selective inhibition .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; C8J_0382; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Target Names
lgt
Target Protein Sequence
MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFVRKFQLDINEKHLDSY FIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFVGIRGMSYHGAIIGFLI ATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFGRITNVPWGIYVDGVLRH PSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLARFICEFYREPDFGIGFVL WGMSMGQILSFIMFITALLVYICIKFKKVNI
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links

KEGG: cju:C8J_0382

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Prolipoprotein diacylglyceryl transferase (lgt) in Campylobacter jejuni?

Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the first step in bacterial lipoprotein biosynthesis, transferring a diacylglyceryl moiety from phosphatidylglycerol to a cysteine residue in the lipobox of prolipoproteins. In C. jejuni, lgt plays a crucial role in the formation of the outer membrane structure by facilitating proper lipoprotein anchoring. This enzyme is essential for bacterial growth, virulence, and pathogenesis, as lipoproteins are major constituents of the bacterial outer membrane and contribute significantly to membrane integrity and function .

How does lgt contribute to Campylobacter jejuni pathogenesis?

Lgt contributes to C. jejuni pathogenesis through its fundamental role in lipoprotein biosynthesis. Lipoproteins are essential components of the bacterial outer membrane that facilitate host-pathogen interactions, immune evasion, and virulence. The absence or inhibition of lgt leads to disruption of outer membrane integrity, which makes bacteria more susceptible to serum killing, antibiotics, and other environmental stresses . Additionally, properly processed lipoproteins are involved in adhesion, invasion, and colonization of intestinal epithelial cells, which are critical processes in C. jejuni infection and subsequent pathogenesis .

What is the relationship between lgt and lipooligosaccharide (LOS) in C. jejuni?

While lgt and LOS are distinct components of C. jejuni's outer membrane, they both contribute to membrane structure and pathogenesis. Lgt is involved in lipoprotein biosynthesis, while LOS is a major glycolipid component of the outer membrane. LOS in C. jejuni consists of lipid A, a core oligosaccharide, and a non-repeating oligosaccharide structure . The proper function of lipoproteins (processed by lgt) may influence LOS organization and presentation on the cell surface. Both structures are critical for bacterial survival and virulence, and mutations in genes related to either pathway can affect C. jejuni's ability to invade intestinal epithelial cells .

What are the best methods for expressing and purifying recombinant C. jejuni lgt?

For optimal expression and purification of recombinant C. jejuni lgt, researchers should consider the following methodology:

  • Expression System Selection: E. coli BL21(DE3) is commonly used for expression of recombinant bacterial membrane proteins.

  • Vector Design: Incorporate a C-terminal or N-terminal His-tag for affinity purification, ensuring the tag doesn't interfere with the active site.

  • Culture Conditions: Growth at lower temperatures (16-20°C) after induction can improve proper folding of membrane proteins.

  • Membrane Extraction: Use a combination of detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100 for extraction from the membrane fraction.

  • Purification Steps:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Size exclusion chromatography to improve purity

    • Consider ion exchange chromatography as a final polishing step

  • Activity Validation: Assess enzyme activity using the glycerol phosphate release assay, which measures the release of glycerol phosphate as a byproduct of the lgt-catalyzed reaction .

How can I create and validate lgt mutants in C. jejuni?

Creating and validating lgt mutants in C. jejuni requires a systematic approach:

  • Mutant Generation:

    • Use site-directed mutagenesis for specific amino acid changes

    • For knockout mutants, employ homologous recombination with antibiotic resistance cassettes (such as chloramphenicol resistance)

    • Consider in vitro transposition systems (like EZ::TN pMOD) as described for other C. jejuni genes

  • Transformation Protocol:

    • Electroporate the construct into C. jejuni (typically strain 81-176 or NCTC 11168)

    • Select transformants on Mueller-Hinton agar with appropriate antibiotics

    • Incubate under microaerophilic conditions at 37°C

  • Validation Steps:

    • PCR verification using primers flanking the insertion site

    • Sequencing to confirm the mutation

    • Western blot analysis to confirm absence/alteration of lgt protein

    • Complementation studies to restore wild-type phenotype

  • Phenotypic Characterization:

    • Assess growth rates in various media

    • Evaluate membrane integrity using dye permeability assays

    • Measure susceptibility to antimicrobials and serum killing

    • Assess invasion capability using intestinal epithelial cell models

What assays can be used to measure lgt enzymatic activity in vitro?

Several assays can be employed to measure lgt enzymatic activity:

  • Glycerol Phosphate Release Assay:

    • This method measures the release of glycerol phosphate (G1P or G3P) as a byproduct of lgt-catalyzed transfer of diacylglyceryl

    • The detection can be coupled to a luciferase reaction for sensitivity

    • The peptide substrate can be derived from known lipoproteins such as Pal (Pal-IAAC where C is the conserved cysteine)

  • Radiolabeled Substrate Incorporation:

    • Using radiolabeled phosphatidylglycerol to track transfer of diacylglyceryl group

    • Quantification by scintillation counting or autoradiography

  • HPLC/Mass Spectrometry-Based Assays:

    • Direct detection of modified peptide substrates

    • Quantification of substrate depletion and product formation

    • Can provide detailed kinetic parameters

  • Fluorescence-Based Assays:

    • Using fluorescently labeled peptide substrates

    • Monitoring changes in fluorescence upon modification

    • Allows for real-time monitoring of enzyme activity

A typical reaction mixture would contain purified lgt enzyme, phosphatidylglycerol substrate, peptide substrate containing the lipobox sequence, and appropriate buffers with divalent cations (usually Mg²⁺).

What are the key structural features of C. jejuni lgt and how do they compare to lgt from other bacterial species?

Key structural features of C. jejuni lgt include:

  • Membrane Topology: C. jejuni lgt is predicted to be an integral membrane protein with multiple transmembrane domains, similar to E. coli lgt .

  • Active Site: The catalytic site likely contains conserved residues that coordinate the diacylglyceryl transfer reaction, including histidine and arginine residues that interact with the phosphate group of phosphatidylglycerol.

  • Substrate Binding Pocket: Contains regions for binding both the phospholipid donor and the prolipoprotein acceptor.

Comparison with other bacterial species:

FeatureC. jejuni lgtE. coli lgtOther Gram-negative lgt
Size~30-35 kDa~33 kDa30-40 kDa
Transmembrane domainsMultiple (predicted 5-7)75-7 typically
Conserved motifsY-x-x-x-E/D motifY-x-x-x-E motifY-x-x-x-E/D motif
Essential geneYesYesYes in most species
Inhibition sensitivitySimilar profile to E. coliWell-characterizedVaries by species

The structural conservation across different bacterial species suggests evolutionary pressure to maintain lgt function, though specific adaptations may exist in C. jejuni to accommodate its unique membrane composition and environmental niche.

How does substrate specificity of C. jejuni lgt differ from other bacterial species?

C. jejuni lgt substrate specificity shows both similarities and differences compared to other bacterial species:

  • Lipobox Recognition: C. jejuni lgt recognizes the canonical lipobox sequence (L-x-x-C), but may have subtle preferences for specific amino acids at the -3 and -2 positions relative to the conserved cysteine.

  • Phospholipid Donor Preference: While most bacterial lgt enzymes preferentially use phosphatidylglycerol as the diacylglyceryl donor, C. jejuni lgt may have evolved preferences for specific fatty acid compositions that predominate in C. jejuni membranes.

  • Environmental Adaptations: C. jejuni grows optimally at 42°C (avian body temperature) and under microaerophilic conditions, which may result in adaptations in lgt substrate specificity compared to E. coli lgt that functions at 37°C under aerobic or anaerobic conditions .

  • Species-Specific Lipoproteins: C. jejuni possesses unique lipoproteins that are not found in other bacteria, suggesting potential adaptations in lgt to efficiently process these species-specific substrates.

These differences in substrate specificity could be exploited for the development of C. jejuni-specific lgt inhibitors for potential therapeutic applications.

What post-translational modifications affect lgt function in C. jejuni?

Several post-translational modifications may impact lgt function in C. jejuni:

  • Phosphorylation: Potential phosphorylation sites on serine, threonine, or tyrosine residues could regulate lgt activity in response to environmental cues.

  • Oxidative Modifications: As C. jejuni grows in microaerophilic environments, oxidative stress may lead to the formation of disulfide bonds or other oxidative modifications that affect enzyme structure and function.

  • Membrane Lipid Interactions: The local lipid environment may modulate lgt activity through specific lipid-protein interactions, particularly with phospholipids that compose the C. jejuni inner membrane.

  • Temperature-Dependent Conformational Changes: As C. jejuni can grow at various temperatures (37°C in humans, 42°C in birds), temperature-induced conformational changes may regulate lgt activity across different hosts.

Experimental approaches to study these modifications include mass spectrometry-based proteomics, site-directed mutagenesis of potential modification sites, and activity assays under different environmental conditions to assess functional impacts.

How can structural information about lgt be used for rational inhibitor design?

Rational inhibitor design targeting C. jejuni lgt can be approached through multiple strategies:

  • Structure-Based Design:

    • Using homology models based on related bacterial lgt structures

    • Molecular docking to identify potential binding pockets

    • Virtual screening of compound libraries against identified binding sites

    • Fragment-based drug design focusing on the catalytic site

  • Mechanism-Based Inhibitors:

    • Design of phosphatidylglycerol analogs that can compete with the natural substrate

    • Development of transition state mimics that bind tightly to the active site

    • Creation of covalent inhibitors targeting conserved active site residues

  • Peptide-Based Approaches:

    • Design of lipobox peptide analogs that compete with natural substrates

    • Peptidomimetics that bind to the substrate recognition site

  • Allosteric Inhibitors:

    • Identification of allosteric sites that can modulate enzyme activity

    • Design of compounds that lock the enzyme in an inactive conformation

Promising compounds identified through these approaches should demonstrate potent Lgt inhibition in biochemical assays and show bactericidal activity against wild-type C. jejuni strains . The inhibitor G9066 identified for E. coli Lgt provides a potential starting point for developing C. jejuni-specific inhibitors.

What are the challenges in developing lgt inhibitors as potential antimicrobials against C. jejuni?

Developing lgt inhibitors as antimicrobials against C. jejuni faces several challenges:

  • Membrane Penetration:

    • Inhibitors must cross the outer membrane to reach lgt in the inner membrane

    • C. jejuni has unique membrane composition that may affect permeability

  • Selectivity Issues:

    • Ensuring selectivity for bacterial lgt over human enzymes

    • Distinguishing between C. jejuni lgt and commensal bacterial lgt to minimize microbiome disruption

  • Resistance Development:

    • Identifying potential resistance mechanisms

    • Unlike other lipoprotein processing enzymes, resistance to lgt inhibition may not be easily achieved through deletion of major outer membrane lipoproteins (e.g., lpp)

  • Pharmacokinetics/Pharmacodynamics:

    • Achieving sufficient concentration at infection sites

    • Maintaining stability in the gastrointestinal environment for treating C. jejuni infections

  • Validation Challenges:

    • Limited animal models that accurately recapitulate human C. jejuni infection

    • Need for appropriate biomarkers to assess inhibitor efficacy in vivo

  • Combination Approaches:

    • Determining optimal combinations with existing antibiotics

    • Identifying synergistic effects with other antimicrobial strategies

Addressing these challenges requires collaborative approaches between structural biologists, medicinal chemists, microbiologists, and clinicians.

How does lgt function relate to immune evasion mechanisms in C. jejuni?

Lgt function contributes to C. jejuni immune evasion through several mechanisms:

  • Lipoprotein-Mediated Immune Modulation:

    • Properly processed lipoproteins may interact with host immune receptors (e.g., TLRs) to modulate inflammatory responses

    • Some lipoproteins may mimic host structures to evade recognition

  • LOS Structural Presentation:

    • Lipoproteins processed by lgt may influence the organization and presentation of LOS on the bacterial surface

    • LOS in C. jejuni can mimic human gangliosides and other glycoconjugates, potentially leading to immune evasion through molecular mimicry

  • Membrane Integrity and Stress Responses:

    • Functional lgt ensures proper membrane integrity, which protects against complement-mediated killing and antimicrobial peptides

    • Properly anchored lipoproteins participate in stress response pathways that help bacteria survive host defense mechanisms

  • Phase Variation and Antigenic Diversity:

    • Similar to LOS structures that undergo phase-variable expression , certain lipoproteins processed by lgt may be subject to phase variation

    • This antigenic variation could contribute to evasion of adaptive immune responses

  • Biofilm Formation:

    • Lipoproteins may participate in biofilm formation, providing protection against host defenses and antimicrobials

Understanding these connections between lgt function and immune evasion may provide new avenues for therapeutic intervention or vaccine development against C. jejuni infections.

How can recombinant C. jejuni lgt be utilized in vaccine development strategies?

Recombinant C. jejuni lgt can be incorporated into vaccine development through several approaches:

  • Attenuated Strain Development:

    • Creation of lgt-attenuated C. jejuni strains with regulated expression

    • Such strains would have compromised outer membrane integrity but retain immunogenicity

    • Safety profile testing would be essential as complete deletion may be lethal

  • Subunit Vaccine Components:

    • Recombinant lgt itself as an antigen

    • Lipoproteins processed by lgt as vaccine antigens

    • Co-administration with adjuvants to enhance immunogenicity

  • Adjuvant Development:

    • Using lgt-processed lipoproteins as natural adjuvants

    • Leveraging the immunostimulatory properties of bacterial lipoproteins

  • Carrier Protein Applications:

    • Using lgt to create lipidated carrier proteins for capsular polysaccharide conjugate vaccines

    • This approach could enhance immune recognition of capsular polysaccharides from C. jejuni

  • Structural Vaccinology:

    • Identifying conserved, surface-exposed epitopes of lgt for targeted immune responses

    • Design of chimeric antigens incorporating these epitopes

A key consideration in these approaches is avoiding structures that might induce autoimmunity, particularly given the known association between C. jejuni LOS and Guillain-Barré syndrome . Careful antigen selection and extensive safety testing would be required.

What are the implications of lgt inhibition for treating C. jejuni infections?

Inhibition of lgt in C. jejuni presents several therapeutic implications:

  • Antimicrobial Efficacy:

    • Lgt inhibitors could be bactericidal against C. jejuni, similar to effects observed in E. coli

    • Potentially effective against antibiotic-resistant strains due to the novel target

  • Membrane Permeabilization Effects:

    • Lgt inhibition leads to outer membrane permeabilization

    • This could increase susceptibility to conventional antibiotics, allowing for lower doses or resensitization of resistant strains

  • Reduced Virulence:

    • Disruption of lipoprotein processing may attenuate virulence without requiring bacterial killing

    • This "anti-virulence" approach might reduce selective pressure for resistance development

  • Potential Combination Therapies:

    • Synergistic effects with:

      • Serum complement (due to increased membrane susceptibility)

      • Conventional antibiotics (due to enhanced penetration)

      • Host antimicrobial peptides

  • Resistance Considerations:

    • Unlike inhibitors of other lipoprotein processing steps, resistance to lgt inhibition may not emerge through deletion of major outer membrane lipoproteins

    • Monitoring for potential resistance mechanisms is essential

  • Delivery Challenges:

    • For intestinal infections, oral formulations would need to survive gastric transit

    • Targeted delivery systems might enhance efficacy at infection sites

Research into these implications is important for advancing novel therapeutic strategies against C. jejuni infections, particularly given rising antibiotic resistance concerns.

How does understanding lgt function contribute to diagnosing post-infectious sequelae of C. jejuni?

Understanding lgt function provides insights into diagnosing post-infectious sequelae of C. jejuni through several mechanisms:

  • Autoimmunity Biomarkers:

    • Lipoproteins processed by lgt may contribute to autoimmune responses

    • Similar to LOS structures that mimic human gangliosides and trigger Guillain-Barré syndrome (GBS) , certain lipoproteins may share epitopes with human tissues

    • Monitoring antibodies against specific lipoproteins could serve as biomarkers for post-infectious autoimmunity risk

  • Strain Virulence Prediction:

    • Genetic analysis of lgt and its target lipoproteins across C. jejuni strains

    • Identification of specific lgt variants or activity levels associated with increased risk of post-infectious complications

    • Development of PCR-based diagnostics to identify high-risk strains

  • Host-Pathogen Interaction Assessment:

    • Analysis of host immune responses to lgt-processed lipoproteins

    • Correlation between specific immune signatures and development of sequelae

    • Potential for early intervention based on immune profiling

  • Lipidomic and Proteomic Approaches:

    • Characterization of lipoprotein modifications in different C. jejuni strains

    • Identification of specific lipoprotein patterns associated with GBS, reactive arthritis, or inflammatory bowel disease

    • Development of mass spectrometry-based diagnostic approaches

  • Longitudinal Monitoring Framework:

    • Establishing protocols for monitoring patients after C. jejuni infection

    • Using lipoprotein-specific antibody titers as part of risk assessment

    • Creating diagnostic algorithms that incorporate multiple biomarkers

This knowledge contributes to developing more sophisticated diagnostic tools for predicting which patients might develop serious post-infectious complications following C. jejuni infection.

How can I address challenges in expressing active recombinant C. jejuni lgt?

Researchers frequently encounter challenges when expressing active recombinant C. jejuni lgt. Here are methodological solutions to common issues:

  • Poor Expression Levels:

    • Try codon optimization for the expression host

    • Use stronger or inducible promoters (T7, tac)

    • Test different E. coli strains (BL21(DE3), C41(DE3), C43(DE3) specifically designed for membrane proteins)

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

  • Inclusion Body Formation:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use fusion partners that enhance solubility (MBP, SUMO, Thioredoxin)

  • Improper Membrane Integration:

    • Include E. coli phospholipids during purification

    • Use mild detergents for extraction (DDM, LDAO)

    • Consider amphipol or nanodisc reconstitution for maintaining native-like environment

    • Test expression in cell-free systems with added liposomes

  • Loss of Activity During Purification:

    • Maintain reducing conditions throughout (DTT or β-mercaptoethanol)

    • Include glycerol (10-20%) in all buffers

    • Add phospholipids during purification

    • Minimize exposure to extreme pH and temperature

    • Consider on-column refolding techniques

  • Verification of Activity:

    • Develop a sensitive assay for even low activity detection

    • Compare activity in different detergent and lipid environments

    • Use known E. coli lgt substrates as positive controls

    • Test activity under microaerophilic conditions mimicking C. jejuni environment

A systematic approach addressing these challenges can significantly improve the yield of active recombinant C. jejuni lgt for structural and functional studies.

What controls should be included when evaluating lgt inhibitors against C. jejuni?

When evaluating potential lgt inhibitors against C. jejuni, the following controls are essential:

  • Enzymatic Assay Controls:

    • Positive Control: Known lgt inhibitors like G9066, if available, or general lipid-modifying enzyme inhibitors

    • Negative Control: Structurally similar compounds with no expected lgt inhibition

    • No-Enzyme Control: Reaction mixture without lgt to establish baseline

    • No-Substrate Control: Omitting either phosphatidylglycerol or peptide substrate

    • Denatured Enzyme Control: Heat-inactivated lgt to confirm enzymatic nature of reaction

  • Antimicrobial Activity Controls:

    • Vehicle Control: Solvent used to dissolve inhibitors (DMSO, ethanol)

    • Conventional Antibiotic Control: Standard antibiotics with known efficacy

    • Conditional lgt Mutant: If available, as genetic validation of target

    • Membrane Permeabilizer Control: Known membrane-disrupting agent to compare mechanism

    • Wild-type vs. lgt-depleted Strains: To confirm on-target effects

  • Selectivity Controls:

    • Mammalian Cell Toxicity: Assessing effects on human cell lines

    • Activity Against Other Bacterial Species: Testing against both related and unrelated bacteria

    • Activity Against lgt Mutants: Confirming specificity for the target

    • Other Lipid-modifying Enzymes: Testing against enzymes with similar functions

  • Mechanism Validation Controls:

    • Membrane Integrity Assays: Confirming effects on bacterial membrane

    • Lipoprotein Processing Analysis: Western blots to detect accumulation of unprocessed prolipoproteins

    • Competition Assays: With natural substrates at varying concentrations

    • Time-course Studies: To distinguish bacteriostatic from bactericidal effects

  • Technical Controls:

    • Inter-day Variability Assessment: Replicate experiments on different days

    • Range of Inhibitor Concentrations: Full dose-response curves

    • Multiple C. jejuni Strains: Testing against clinical isolates and reference strains

These controls help establish the specificity, potency, and mechanism of action of potential lgt inhibitors while addressing possible confounding factors in the evaluation process.

How can I optimize C. jejuni growth conditions for studying lgt function?

Optimizing C. jejuni growth conditions for studying lgt function requires careful attention to several parameters:

  • Microaerophilic Environment:

    • Use specialized gas mixtures (5-10% O₂, 5-10% CO₂, 80-85% N₂)

    • Commercial gas-generating sachets (Campy-Gen, Oxoid) can be used

    • Consider microaerophilic chambers or specialized incubators

    • Validate oxygen levels using resazurin indicators

  • Temperature Optimization:

    • Standard growth at 37°C (human host temperature)

    • 42°C for conditions mimicking avian host

    • Compare lgt expression and function at different temperatures

  • Media Selection:

    • Mueller-Hinton (MH) broth is standard for C. jejuni

    • Supplement with blood (5-7%) for enhanced growth

    • For defined studies, use minimal essential media with specific supplements

    • Biphasic cultures (solid-liquid interface) can improve growth

  • Growth Phase Considerations:

    • Monitor growth curves using OD₆₀₀ measurements

    • Harvest cells at consistent growth phases (mid-log is often optimal)

    • Consider that lgt expression may vary across growth phases

  • Supplementation Strategies:

    • Add specific phospholipids to study their effects on lgt function

    • Iron restriction/supplementation to mimic different host environments

    • Bile salts at physiological concentrations to mimic intestinal conditions

  • pH Control:

    • Maintain pH between 6.5-7.5

    • Buffer media appropriately to prevent acidification during growth

    • Consider pH shifts to mimic passage through the GI tract

  • Genetic Manipulation Conditions:

    • Optimize electroporation conditions for transformation

    • Use appropriate selective media for mutant isolation

    • Consider inducible expression systems for conditional mutants

  • Stress Response Considerations:

    • Control for oxidative stress by adding catalase

    • Minimal handling to reduce aerobic exposure

    • Rapid processing for membrane and enzyme preparations

A methodical approach to optimizing these conditions will ensure reliable and reproducible results when studying lgt function in C. jejuni.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.