Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to UppP

Undecaprenyl-diphosphatase (UppP) is an integral membrane enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for peptidoglycan and lipopolysaccharide biosynthesis in Gram-negative bacteria . In Campylobacter jejuni subsp. jejuni serotype O:6, UppP is encoded by the uppP gene (locus tag: cj1545c in strain NCTC 11828) . Recombinant forms of this enzyme are produced to study its biochemical properties and explore therapeutic interventions against campylobacteriosis.

Primary Structure

  • The recombinant UppP protein spans 267 amino acids (aa 1–267) and has a molecular weight of ~35–45 kDa, depending on the expression system .

  • Key functional motifs include two conserved regions:

    • Glutamate-rich motif: (E/Q)XXXE, involved in substrate binding.

    • PGXSRSXXT motif: Critical for catalytic activity .

Active Site and Mechanism

  • Computational modeling and mutagenesis studies propose that UppP’s active site resides near the periplasmic interface, with histidine residues facilitating dephosphorylation .

  • The enzyme operates via a two-step mechanism:

    1. Cleavage of the pyrophosphate bond in UPP.

    2. Release of inorganic phosphate to generate UP .

Production Methods

Recombinant UppP is synthesized using heterologous expression systems:

Expression SystemHostTagPurityApplication
ProkaryoticE. coliN-terminal His>90%Enzyme kinetics, assays
EukaryoticYeast, mammalian cellsNone>85%Structural studies

Data compiled from .

Biochemical Characterization

  • Catalytic Efficiency: Recombinant UppP shows optimal activity at pH 7.5 and 37°C, with a Kₘ of 12 μM for UPP .

  • Inhibitor Sensitivity: The enzyme is inhibited by metal chelators (e.g., EDTA) and alkylating agents, confirming its dependence on divalent cations and cysteine residues .

Genetic and Functional Insights

  • In C. jejuni strain 81116 (NCTC 11828), uppP is regulated by redox-sensing transcriptional regulators RrpA and RrpB, linking its expression to oxidative stress responses .

  • Mutational studies demonstrate that substitutions in the PGXSRSXXT motif reduce enzymatic activity by >90%, underscoring its role in catalysis .

Antimicrobial Target

UppP is a promising target for novel antibiotics, as its inhibition disrupts cell wall synthesis. For example:

  • Small-molecule inhibitors: Screened using recombinant UppP have shown bactericidal effects against C. jejuni .

  • Vaccine Development: UppP-derived epitopes are being explored as components of subunit vaccines against campylobacteriosis .

Enzyme Kinetics Studies

Recombinant UppP is used to investigate:

  • Substrate specificity across bacterial species.

  • Evolutionary conservation of catalytic motifs .

Challenges and Future Directions

  • Structural Limitations: The lack of a high-resolution crystal structure hinders rational drug design .

  • Host Adaptation: Differences in UppP activity between C. jejuni serotypes (e.g., O:6 vs. O:19) require further study to optimize broad-spectrum therapies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please communicate your preference, and we will prioritize its development.
Synonyms
uppP; C8J_0194; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Target Names
uppP
Target Protein Sequence
MENLNALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAAGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Conveys resistance to bacitracin.
Database Links

KEGG: cju:C8J_0194

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni undecaprenyl-diphosphatase (uppP) and what is its primary function?

Campylobacter jejuni undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase, is an essential enzyme involved in bacterial cell wall biosynthesis . Its primary function is to dephosphorylate C55 diphosphate (undecaprenyl pyrophosphate or Und-PP) to produce undecaprenyl phosphate (Und-P) .

This dephosphorylation step is critical because Und-P serves as an essential lipid carrier that plays a key role in the biosynthesis of lipooligosaccharide (LOS) and other cell wall components in gram-negative bacteria . The enzyme functions within a metabolic pathway where undecaprenyl pyrophosphate synthase (UppS) first catalyzes the sequential addition of isopentyl diphosphate (IPP) with farnesyl diphosphate to yield undecaprenyl diphosphate (Und-PP), which is then dephosphorylated by uppP to generate the active carrier lipid Und-P .

What is the structural basis for Campylobacter jejuni uppP activity?

While the provided search results don't include specific structural information about C. jejuni uppP itself, insights can be drawn from related enzymes. Undecaprenyl pyrophosphate synthase, which works in the same pathway as uppP, has been characterized as a highly flexible protein with mobile binding pockets in its active site .

The X-ray crystallographic structure of Escherichia coli apo-undecaprenyl pyrophosphate synthase shows that these enzymes can adopt different conformational states depending on ligand binding . Similar structural flexibility may be present in C. jejuni uppP, potentially allowing it to accommodate its substrate and facilitate the dephosphorylation reaction. This structural flexibility could be key to enzyme function and may influence inhibitor binding, which has implications for antimicrobial drug development targeting this enzyme .

How is uppP related to bacterial pathogenesis and antimicrobial resistance?

Undecaprenyl-diphosphatase (uppP) is directly linked to bacterial pathogenesis and antimicrobial resistance through its essential role in cell wall biosynthesis. The enzyme's alternative name - "Bacitracin resistance protein" - indicates its involvement in resistance to bacitracin, an antibiotic that targets cell wall synthesis .

In C. jejuni, uppP activity is particularly important as it produces Und-P, the essential lipid carrier required for lipooligosaccharide (LOS) biosynthesis . LOS structures are critical virulence determinants in gram-negative bacteria like C. jejuni. Additionally, the importance of uppP in cell wall synthesis makes it an attractive target for antimicrobial therapy . Inhibition of this enzyme could potentially disrupt cell wall synthesis and lead to bacterial cell death, suggesting its potential as a novel antimicrobial target.

How does N-linked glycosylation in Campylobacter jejuni interact with undecaprenyl phosphate metabolism?

Research indicates a significant relationship between N-linked glycosylation and undecaprenyl phosphate metabolism in C. jejuni. Quantitative proteomic studies show that glycosylation-deficient C. jejuni strains (pglB::aphA mutants) exhibit a substantial reduction in MEP pathway enzymes compared to wild-type strains . This pathway is responsible for producing isopentyl diphosphate (IPP), the precursor for undecaprenyl phosphate synthesis.

Notably, a 47% reduction in UppS (undecaprenyl pyrophosphate synthase) abundance was observed in glycosylation-deficient C. jejuni compared to wild-type bacteria . Since UppS catalyzes the production of Und-PP, which is subsequently dephosphorylated by uppP to yield Und-P, this finding suggests that N-linked glycosylation influences the availability of the essential lipid carrier Und-P. This relationship may explain why glycosylation-deficient strains show altered cell morphology and reduced survival in avian hosts, which are primary reservoirs for zoonotic C. jejuni infections .

The following table summarizes the differential expression of isoprenoid biosynthesis enzymes in glycosylation-deficient C. jejuni:

EnzymePathway% Reduction in Glycosylation-deficient StrainFunction
MEP pathway enzymesIsoprenoid precursor synthesisSignificantProduction of IPP
UppSUnd-PP synthesis47%Catalyzes IPP + farnesyl diphosphate → Und-PP
UppPUnd-P productionNot specifiedDephosphorylates Und-PP → Und-P

What experimental approaches can be used to study recombinant uppP activity and inhibition?

Several experimental approaches can be employed to study recombinant Campylobacter jejuni uppP:

  • Recombinant protein expression systems: The enzyme can be expressed in various systems including E. coli, yeast, baculovirus, or mammalian cells, each with different advantages for protein folding and post-translational modifications . Tag systems such as Avi-tag Biotinylated can be incorporated for detection and purification purposes .

  • Molecular dynamics simulations: As demonstrated with related enzymes like undecaprenyl pyrophosphate synthase, molecular dynamics simulations can provide valuable insights into protein flexibility and identify rarely sampled ligand-bound conformational states . This approach can reveal how structurally dissimilar compounds might bind preferentially to different conformational states of the enzyme.

  • Enzyme assays: Phosphatase activity can be measured using colorimetric or fluorescent assays that detect phosphate release from the substrate (Und-PP). These assays can be adapted for high-throughput screening of potential inhibitors.

  • Crystallography and structural analysis: X-ray crystallography can determine the three-dimensional structure of uppP, particularly in complex with substrates or inhibitors . This structural information is essential for understanding the enzyme's mechanism and for structure-based drug design.

  • Chemoenzymatic approaches: As demonstrated in related research, chemoenzymatic methods involving modified substrates (such as benzylazide-tagged isoprenoids) can be valuable for studying enzyme activity and for creating immobilized enzyme systems .

How can synthetic substrates and analogs be designed to study uppP function?

The design of synthetic substrates and analogs for studying uppP function can be approached through several sophisticated strategies:

  • Chemical modification of natural substrates: The natural substrate, undecaprenyl pyrophosphate, can be modified to incorporate chemical handles such as benzylazide tags. This approach has been successfully used in related systems, where both organic-soluble and water-soluble benzylazide isoprenoid analogs served as substrates for glycan assembly systems .

  • Shortening of the isoprenoid chain: Natural Und-PP contains a C55 polyisoprenoid chain which can be difficult to work with in vitro due to its hydrophobicity. Shorter chain analogs may be designed that maintain substrate recognition while improving solubility and ease of handling .

  • Fluorescent or radioactive labeling: Incorporating fluorescent groups or radioactive isotopes into substrate analogs can facilitate tracing and quantification of enzyme activity through spectroscopic or radiometric assays.

  • Photoaffinity labeling: Substrates modified with photoactivatable groups can be used to probe the binding site architecture through covalent crosslinking upon UV irradiation.

  • Conformationally constrained analogs: Based on molecular dynamics simulations that identify key conformational states of the enzyme , substrates can be designed that preferentially bind to specific conformational states, providing insights into the catalytic mechanism.

These synthetic approaches not only enable fundamental studies of uppP catalysis but also provide platforms for inhibitor discovery and development.

What are the optimal conditions for expressing and purifying recombinant C. jejuni uppP?

The expression and purification of recombinant Campylobacter jejuni uppP requires careful consideration of several factors to maximize yield and maintain enzyme activity:

  • Expression systems: Several expression systems are viable for producing recombinant C. jejuni uppP, including E. coli, yeast, baculovirus, and mammalian cells . Each system offers different advantages:

    • E. coli provides high yield and cost-effectiveness but may struggle with proper folding of membrane proteins

    • Yeast combines reasonable yield with eukaryotic folding machinery

    • Baculovirus and mammalian systems offer superior folding and post-translational modifications but at higher cost and lower yield

  • Protein tags: The inclusion of affinity tags facilitates purification and can enhance protein solubility. Available options include:

    • Avi-tag Biotinylated: Allows for highly specific biotinylation catalyzed by E. coli biotin ligase (BirA), enabling streptavidin-based affinity purification and detection

    • Other common tags like His6, GST, or MBP may also be considered depending on the experimental requirements

  • Membrane protein considerations: As uppP is a membrane-associated enzyme, special attention should be paid to extraction and solubilization methods:

    • Detergent screening to identify optimal surfactants for solubilization

    • Consideration of nanodiscs or liposomes for maintaining the native membrane environment

    • Potential use of truncated constructs that maintain catalytic activity while improving solubility

  • Quality control: The purity of recombinant uppP should be verified using SDS-PAGE (>85% purity standard is commonly used) , and activity assays should confirm that the purified enzyme maintains its dephosphorylation function.

How can the role of uppP in C. jejuni pathogenesis be experimentally validated?

Validating the role of uppP in C. jejuni pathogenesis requires a multifaceted experimental approach:

  • Gene knockout and complementation studies: Creating uppP deletion mutants in C. jejuni and analyzing phenotypic changes in growth, morphology, and virulence. Complementation with wild-type uppP should restore these phenotypes if the gene is directly involved in pathogenesis. Scanning electron microscopy can be used to observe morphological changes similar to those observed in glycosylation-deficient strains .

  • Conditional expression systems: Since uppP may be essential, conditional expression systems (temperature-sensitive promoters or inducible systems) can allow for controlled depletion of the enzyme to study its effects on bacterial viability and pathogenicity.

  • Infection models: Comparing the ability of wild-type and uppP-mutant C. jejuni to:

    • Colonize avian hosts, which are natural reservoirs for C. jejuni

    • Cause gastroenteritis in appropriate animal models

    • Adhere to and invade intestinal epithelial cells in tissue culture models

  • Biochemical analysis: Examining changes in cell wall composition and lipooligosaccharide (LOS) structure in uppP-deficient strains, as LOS is a key virulence determinant in C. jejuni .

  • Antibiotic susceptibility testing: Determining whether alterations in uppP expression affect resistance to antibiotics targeting cell wall synthesis, such as bacitracin.

  • Interaction with N-linked glycosylation system: Investigating the relationship between uppP function and the N-linked protein glycosylation system, which has been shown to be required for full competence in C. jejuni 81-176 and appears to be linked to isoprenoid metabolism .

What bioinformatic approaches can predict potential inhibitors of C. jejuni uppP?

Several bioinformatic approaches can be employed to predict potential inhibitors of C. jejuni undecaprenyl-diphosphatase:

  • Homology modeling and molecular dynamics: If crystal structures of C. jejuni uppP are unavailable, homology models can be built based on related bacterial phosphatases. Molecular dynamics simulations can then identify rarely sampled conformational states that might be targeted by inhibitors, as demonstrated with undecaprenyl pyrophosphate synthase . These simulations can reveal expanded pocket states that are key to drug design but might not be evident in static crystal structures.

  • Virtual screening and docking: Large compound libraries can be virtually screened against the enzyme structure or model to identify molecules predicted to bind at the active site or allosteric sites. Docking studies should account for protein flexibility by using multiple conformational states extracted from molecular dynamics simulations .

  • Pharmacophore modeling: By analyzing known phosphatase inhibitors, pharmacophore models can be developed that capture the essential features required for inhibitor binding and activity.

  • Sequence and structural conservation analysis: Identifying highly conserved residues across bacterial uppP homologs can highlight essential catalytic or structural elements that might serve as optimal targets for inhibitor design.

  • Machine learning approaches: Training machine learning models on datasets of known phosphatase inhibitors can help predict new chemical scaffolds likely to inhibit uppP activity.

  • Fragment-based drug design: In silico fragment screening can identify small molecular building blocks that bind to different regions of the enzyme, which can then be linked or expanded to create more potent inhibitors.

These computational approaches should ideally be integrated with experimental validation to confirm predictions and refine inhibitor design strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.