Recombinant Campylobacter jejuni Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Characteristics and Function

Undecaprenyl-diphosphatase (uppP) (EC 3.6.1.27) is a membrane-associated enzyme pivotal in bacterial cell wall synthesis. Its activity regenerates Und-P, which shuttles glycans across the cytoplasmic membrane for incorporation into the cell wall . Key features include:

  • Catalytic Role: Hydrolyzes Und-PP → Und-P + inorganic phosphate .

  • Structural Motifs: Contains conserved domains for pyrophosphatase activity, with a 267-amino acid sequence in C. jejuni strains (e.g., RM1221, 81-176) .

  • Genetic Context: The uppP gene is linked to bacitracin resistance, as Und-P recycling is targeted by this antibiotic .

Research Applications

  • Glycobiology Studies: Used to investigate Und-P-dependent glycosylation pathways, such as the C. jejuni Pgl system for N-linked glycans .

  • Antibiotic Development: Target for inhibitors disrupting cell wall synthesis, given its role in bacitracin resistance .

  • Vaccine Antigens: Evaluated as a component in subunit vaccines against C. jejuni-induced gastroenteritis .

Handling and Stability

  • Reconstitution: Lyophilized protein requires gentle reconstitution in sterile water, with glycerol (5–50%) added for stability .

  • Aliquoting: Working aliquots stored at 4°C degrade within a week; freeze-thaw cycles degrade activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify your needs during order placement. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; CJE0198; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Campylobacter jejuni (strain RM1221)
Target Names
uppP
Target Protein Sequence
MENLYALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFIVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: cjr:CJE0198

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter jejuni Undecaprenyl-diphosphatase (uppP) and its biological significance?

Campylobacter jejuni uppP is an enzyme classified as undecaprenyl-diphosphatase that plays a critical role in cell wall biosynthesis in this bacterial pathogen. The protein (strain 81-176) consists of 267 amino acids and functions by dephosphorylating C55 diphosphate to produce bactoprenol phosphate (BP) . This dephosphorylation step is essential for recycling the lipid carrier during bacterial cell wall biosynthesis.

C. jejuni is a Gram-negative, spiral-shaped, nonspore-forming, microaerophilic bacterium that can transform into a coccal form when exposed to atmospheric oxygen. It is one of the most common causes of human gastroenteritis worldwide and is frequently associated with poultry, naturally colonizing the digestive tract of many bird species .

How does recombinant C. jejuni uppP differ from native uppP?

Recombinant C. jejuni uppP refers to the protein produced using heterologous expression systems rather than isolated directly from C. jejuni. The recombinant form typically includes the full amino acid sequence (aa 1-267) of the native protein but may contain additional features such as purification tags or fusion partners to facilitate isolation and characterization.

Common expression systems for recombinant C. jejuni uppP include E. coli, yeast, baculovirus, and mammalian cell systems . Each expression system offers distinct advantages and challenges:

Expression SystemAdvantagesChallenges
E. coliHigh yield, rapid growth, economicalPotential for inclusion bodies, limited post-translational modifications
YeastEukaryotic post-translational modifications, secretion possibleLonger production time, different glycosylation patterns
BaculovirusComplex eukaryotic modifications, high expressionMore technically demanding, higher cost
MammalianMost authentic post-translational modificationsHighest cost, lowest yield, complex media requirements

What experimental design considerations are critical when studying C. jejuni uppP?

When designing experiments to study C. jejuni uppP, researchers should implement a systematic approach following established experimental design principles:

  • Define clear objectives: Determine whether you are studying enzymatic activity, structural properties, or interactions with other cellular components .

  • Select appropriate factors: Identify independent variables that may affect uppP function (e.g., pH, temperature, substrate concentration, presence of potential inhibitors) .

  • Choose relevant responses and measurement systems: Establish sensitive and reproducible assays to measure uppP activity, such as phosphate release assays or chromatographic methods to detect substrate conversion .

  • Select optimal experimental design: For initial characterization, screening experiments are recommended to explore multiple factors. For detailed analysis, factorial or response surface designs may be more appropriate .

  • Execute experiments with precision: Standardize protocols to minimize variability and ensure reproducibility of results .

  • Analyze data thoroughly: Apply appropriate statistical methods to establish relationships between experimental factors and measured responses .

  • Verify predicted results: Confirm findings with validation experiments under optimized conditions .

How can I design an effective assay to measure C. jejuni uppP enzymatic activity?

An effective assay for measuring C. jejuni uppP activity should focus on detecting either substrate depletion or product formation. A methodological approach includes:

  • Substrate preparation: Prepare C55 diphosphate substrate following established protocols. Alternatively, synthetic analogues with appropriate detection tags can be used .

  • Reaction setup:

    • Buffer composition: Typically phosphate-free buffers (e.g., HEPES, Tris) with pH 7.0-8.0

    • Required cofactors: Divalent metal ions (Mg²⁺ or Mn²⁺)

    • Temperature control: 30-37°C (optimal for most bacterial enzymes)

    • Enzyme concentration: Determine through preliminary titration experiments

  • Detection methods:

    • Colorimetric assays: Measure released inorganic phosphate using malachite green or other phosphate-detection reagents

    • HPLC analysis: Monitor substrate depletion and product formation using amine stationary phase columns

    • Mass spectrometry: LC-MS using SIM detection can track both reactants and products with high sensitivity

  • Controls:

    • Negative control: Reaction mixture without enzyme

    • Positive control: Known phosphatase with similar activity

    • Inhibition control: Reaction with known phosphatase inhibitors

  • Quantification: Generate a standard curve using known concentrations of phosphate or product analogue to quantify enzymatic activity.

What are the optimal methods for purifying recombinant C. jejuni uppP?

Purification of recombinant C. jejuni uppP requires careful consideration of protein properties and expression systems. A comprehensive purification strategy includes:

  • Expression optimization:

    • Select an appropriate expression system based on research needs (E. coli, yeast, baculovirus, or mammalian cells)

    • For E. coli expression, consider strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Cell lysis and membrane protein extraction:

    • For membrane-associated uppP, use gentle detergents (DDM, LDAO, or CHAPS) for solubilization

    • Include protease inhibitors to prevent degradation during extraction

  • Chromatographic purification:

    • Affinity chromatography: If tagged (His, GST, MBP), use appropriate affinity resins

    • Ion exchange chromatography: Based on theoretical pI of uppP

    • Size exclusion chromatography: Final polishing step for homogeneity

  • Quality assessment:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Dynamic light scattering for homogeneity assessment

  • Activity verification:

    • Enzymatic activity assay to confirm functional protein

What structural characterization techniques are most informative for C. jejuni uppP?

Multiple complementary techniques should be employed for comprehensive structural characterization:

  • X-ray crystallography:

    • Optimal for high-resolution structural information

    • Challenges include obtaining diffraction-quality crystals of membrane proteins

    • Consider lipidic cubic phase crystallization for membrane proteins

  • Cryo-electron microscopy (Cryo-EM):

    • Increasingly valuable for membrane protein structures

    • May require formation of larger complexes or incorporation into nanodiscs

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Useful for dynamics and ligand binding studies

    • May be challenging for full-length uppP due to size limitations

    • Consider domain-specific studies

  • Computational modeling:

    • Homology modeling based on related bacterial phosphatases

    • Molecular dynamics simulations to study conformational changes

    • Docking studies for substrate and inhibitor interactions

  • Biophysical characterization:

    • Circular dichroism (CD) for secondary structure assessment

    • Thermal shift assays for stability evaluation

    • Surface plasmon resonance (SPR) for interaction studies

How does uppP function in the C. jejuni N-linked glycosylation pathway?

C. jejuni uppP plays a critical role in the lipid carrier cycle essential for N-linked glycosylation:

  • Lipid carrier recycling: uppP dephosphorylates undecaprenyl pyrophosphate to generate undecaprenyl phosphate (bactoprenol phosphate, BP), which serves as the lipid carrier for oligosaccharide assembly .

  • Integration with Pgl pathway: The recycled BP serves as the foundation for the assembly of the C. jejuni N-linked heptasaccharide, which begins with the addition of N,N-diacetylbacillosamine (diNAcBac) .

  • Pathway sequence:

    • Initiation: UDP-diNAcBac is transferred to BP by PglC

    • Extension: Sequential addition of sugars by glycosyltransferases PglA, PglJ, PglH, and PglI

    • Completion: Formation of the complete heptasaccharide-lipid intermediate

  • Enzymatic coordination: uppP activity must be coordinated with glycosyltransferase activities to maintain appropriate levels of available BP carrier lipid.

What experimental approaches can elucidate uppP interactions with other enzymes in the glycosylation pathway?

To investigate uppP interactions with other enzymes in the C. jejuni glycosylation pathway, consider the following methodological approaches:

How can recombinant C. jejuni uppP be utilized in developing antimicrobial strategies?

Targeting bacterial cell wall biosynthesis presents a validated approach for antimicrobial development. For C. jejuni uppP specifically:

  • High-throughput screening (HTS) platforms:

    • Develop fluorescence-based assays suitable for HTS

    • Screen chemical libraries against purified recombinant uppP

    • Validate hits using secondary orthogonal assays

  • Structure-based drug design:

    • Utilize structural data to identify potential binding pockets

    • Perform in silico docking and virtual screening

    • Design and synthesize targeted inhibitors based on substrate analogues

  • Validation methodologies:

    • Enzymatic assays with purified recombinant uppP

    • Growth inhibition assays with C. jejuni cultures

    • Membrane integrity and cell wall biosynthesis assessments

  • Selectivity profiling:

    • Compare inhibition of C. jejuni uppP versus human phosphatases

    • Assess activity against related bacterial enzymes

    • Evaluate effects on commensal microbiota

What are the best approaches for studying the role of uppP in C. jejuni pathogenesis?

To investigate the role of uppP in C. jejuni pathogenesis, consider these methodological approaches:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 or traditional homologous recombination for gene deletion/modification

    • Complementation studies with wild-type and mutant uppP variants

    • Conditional knockdown systems to study essentiality

  • Infection models:

    • Cell culture-based invasion and adhesion assays

    • Galleria mellonella (wax moth) larvae for preliminary in vivo studies

    • Animal models (typically avian or murine) for comprehensive pathogenesis studies

  • Omics approaches:

    • Transcriptomics to assess global gene expression changes in uppP mutants

    • Proteomics to identify altered protein expression and post-translational modifications

    • Glycomics to assess changes in cellular glycosylation patterns

    • Metabolomics to evaluate metabolic pathway perturbations

  • Experimental design considerations:

    • Define clear hypotheses about uppP's role in specific virulence mechanisms

    • Select appropriate control strains and conditions

    • Implement rigorous statistical analysis of experimental data

    • Validate key findings through complementary methodologies

What are common challenges in working with recombinant C. jejuni uppP and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant C. jejuni uppP:

  • Low expression yields:

    • Solution: Optimize codon usage for the expression host

    • Solution: Test different promoter strengths and induction conditions

    • Solution: Consider fusion partners (MBP, SUMO) to enhance solubility

  • Protein aggregation or inclusion body formation:

    • Solution: Lower induction temperature (16-20°C)

    • Solution: Reduce inducer concentration

    • Solution: Express in specialized strains (e.g., C41/C43 for membrane proteins)

  • Loss of enzymatic activity during purification:

    • Solution: Include stabilizing agents (glycerol, specific lipids)

    • Solution: Minimize purification steps and processing time

    • Solution: Determine optimal detergent type and concentration for extraction

  • Inconsistent enzymatic assay results:

    • Solution: Standardize substrate preparation methods

    • Solution: Implement rigorous positive and negative controls

    • Solution: Develop internal standards for quantification

  • Experimental design challenges:

    • Solution: Follow systematic experimental design principles

    • Solution: Conduct preliminary experiments to identify key variables

    • Solution: Use statistical methods to optimize experimental conditions

How can contradictory data in uppP research be reconciled through experimental design?

When facing contradictory data in uppP research, a methodical approach can help resolve discrepancies:

  • Systematic evaluation of experimental variables:

    • Design experiments that systematically vary one factor at a time while keeping others constant

    • Implement factorial designs to assess interaction effects between variables

    • Utilize statistical tools to identify significant factors affecting outcomes

  • Comparative methodology assessment:

    • Apply multiple independent analytical methods to the same samples

    • Benchmark your methods against established protocols in the field

    • Evaluate the sensitivity and specificity of each method

  • Reproducibility enhancement:

    • Standardize protocols with detailed documentation

    • Implement blind testing where appropriate

    • Conduct inter-laboratory validation when possible

  • Data integration approaches:

    • Use meta-analysis techniques to evaluate conflicting results

    • Develop computational models that account for experimental variability

    • Implement Bayesian analysis to update hypotheses based on new evidence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.