Recombinant Campylobacter lari Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
plsY; Cla_0177; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Target Names
plsY
Target Protein Sequence
MENLIIYLLAYLIGAIPFGLLLAQIFAKTNIKNAGSKSIGATNVLRVVKESNPKLAKTLA VATVILDALKGVLPILMAKFYGFDDNILWTMAVLAVFGHCFSPYLKFEGGKGVATGAGVL AVFLPFEIICALLAWFIIGKVFKISSLASLGAMIVLIATSFIFHYDIPVINTHAPIFIIA FIVVYKHIPNILRLIGKQECKVI
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in bacterial metabolism?

Glycerol-3-phosphate acyltransferase (plsY) is an essential enzyme in bacterial phospholipid biosynthesis that catalyzes the acylation of the 1-position of glycerol-3-phosphate. It represents the most prevalent glycerol-phosphate acyltransferase in the bacterial world and uses acyl-phosphate fatty acid intermediates as acyl donors rather than acyl-CoA thioesters. This unique activated fatty acid is formed from the acyl-ACP end products of the fatty acid biosynthetic pathway by PlsX, an acyl-ACP:phosphate transacylase. PlsY sits at the crucial interface between the soluble type II fatty acid biosynthetic pathway and the creation of phospholipid molecules that drive membrane expansion, making it a key regulator of both fatty acid and phospholipid synthesis in bacteria .

How does plsY differ from other acyltransferases in bacterial phospholipid synthesis?

PlsY differs significantly from PlsB, another glycerol-phosphate acyltransferase found in certain bacteria like Escherichia coli. The key differences include:

  • Substrate specificity: PlsY exclusively uses acyl-phosphate as its acyl donor, while PlsB can utilize either acyl-ACP or acyl-CoA thioesters to acylate glycerol-phosphate .

  • Evolutionary distribution: PlsY is the most prevalent acyltransferase in the bacterial world, whereas PlsB is primarily found in γ-proteobacteria .

  • Membrane topology: PlsY is an integral membrane protein with five membrane-spanning segments, giving it a distinct structural organization .

  • Metabolic implications: In organisms containing PlsB, exogenous fatty acids can be used for membrane phospholipid formation through acyl-CoA utilization, while many Gram-positive bacteria containing only PlsY (like Streptococcus pneumoniae and Bacillus subtilis) cannot utilize acyl-CoA as an acyl donor .

PropertyPlsYPlsB
DistributionWidespread in bacteriaPrimarily in γ-proteobacteria
Acyl donorsAcyl-phosphate onlyAcyl-ACP or acyl-CoA
Exogenous fatty acid utilizationNoYes
Structure5 membrane-spanning segmentsMembrane-bound
PathwayRequires PlsX to convert acyl-ACP to acyl-PO₄Direct utilization of acyl-ACP

What are the optimal storage and handling conditions for recombinant Campylobacter lari plsY?

For optimal preservation of recombinant Campylobacter lari plsY, the following storage and handling protocols are recommended:

  • Long-term storage: Store at -20°C; for extended stability, -80°C storage is advisable.

  • Storage buffer: The protein should be maintained in a Tris-based buffer containing 50% glycerol that has been specifically optimized for plsY stability.

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw degradation.

  • Freeze-thaw considerations: Repeated freezing and thawing should be avoided as this can significantly compromise protein integrity and activity. Creating single-use aliquots is recommended for experimental workflows requiring multiple uses .

  • Pre-experimental preparation: Allow the protein to reach room temperature gradually before use in enzymatic assays to prevent denaturation from rapid temperature changes.

How can researchers design effective assays to measure plsY enzymatic activity?

To design effective assays for measuring Campylobacter lari plsY enzymatic activity, researchers should consider the following methodological approaches:

  • Substrate preparation:

    • Generate acyl-phosphate substrates using purified PlsX enzyme or chemical synthesis

    • Prepare glycerol-3-phosphate substrate at optimal concentrations determined through kinetic analyses

    • Consider using radioactively labeled or fluorescently tagged substrates for sensitive detection

  • Reaction conditions:

    • Buffer composition: Tris-based buffers (pH 7.4-7.6) containing divalent cations (typically Mg²⁺)

    • Temperature: 37°C (physiological) or 30°C (compromise between activity and stability)

    • Reaction termination: Acidification or organic solvent addition

  • Activity measurement options:

    • Direct product detection: HPLC or TLC separation of lysophosphatidic acid product

    • Coupled enzyme assays: Link product formation to NAD⁺/NADH conversion for spectrophotometric detection

    • Release of inorganic phosphate: Colorimetric detection methods

  • Controls and validations:

    • Heat-inactivated enzyme control

    • Substrate-limiting conditions to ensure linearity

    • Acyl chain specificity analysis using different acyl-phosphate donors

  • Membrane reconstitution considerations:

    • As plsY is an integral membrane protein with five membrane-spanning segments, activity may be optimal in a membrane-like environment

    • Consider using liposomes, nanodiscs, or detergent micelles for enzyme stabilization

What expression systems are most effective for producing functional recombinant Campylobacter lari plsY?

The production of functional recombinant Campylobacter lari plsY presents unique challenges due to its nature as an integral membrane protein. Based on research practices with similar proteins, the following expression systems can be considered:

  • E. coli-based systems:

    • C41(DE3) or C43(DE3) strains: Engineered specifically for membrane protein expression

    • BL21(DE3) pLysS: Provides tight control of expression to reduce toxicity

    • Expression tags: N-terminal His₆ or His₁₀ tags facilitate purification while minimally affecting function

    • Induction conditions: Low IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-25°C) often improve folding

  • Cell-free expression systems:

    • Allow direct incorporation into liposomes during synthesis

    • Provide controlled membrane-mimetic environments

    • Reduce toxicity issues encountered in cellular systems

  • Insect cell expression:

    • Baculovirus expression systems offer eukaryotic processing capabilities

    • Better membrane protein folding machinery than bacterial systems

  • Purification strategies:

    • Solubilization using mild detergents (DDM, LDAO)

    • Affinity chromatography followed by size exclusion

    • Functional reconstitution into liposomes or nanodiscs for activity assays

Each expression system requires optimization of codon usage, induction timing, and extraction conditions to preserve the native structure and function of this membrane-integrated enzyme.

How can Campylobacter lari plsY be used to study bacterial membrane biogenesis?

Campylobacter lari plsY represents an excellent molecular tool for investigating bacterial membrane biogenesis through several research approaches:

  • Metabolic flux analysis:

    • Using isotopically labeled glycerol-3-phosphate or acyl donors to track phospholipid synthesis rates

    • Measuring the incorporation of labeled precursors into membrane phospholipids under different growth conditions

    • Quantifying the rate-limiting steps in membrane expansion during bacterial growth

  • Regulatory network studies:

    • Creating conditional expression strains to study phospholipid homeostasis mechanisms

    • Investigating feedback loops between fatty acid synthesis and phospholipid incorporation

    • Examining transcriptional and post-translational regulation of plsY expression

  • Membrane composition engineering:

    • Modifying plsY substrate specificity through directed evolution or rational design

    • Altering acyl chain preferences to create bacteria with modified membrane compositions

    • Studying the physiological effects of altered phospholipid compositions on membrane properties

  • Structural biology approaches:

    • Using purified plsY in crystallization trials or cryo-EM studies to determine high-resolution structures

    • Performing molecular dynamics simulations to understand enzyme-membrane interactions

    • Investigating the structural basis for acyl chain selectivity through mutagenesis studies

  • Interface with other biosynthetic pathways:

    • Exploring the physical or functional interactions between plsY and enzymes of the fatty acid synthesis pathway

    • Investigating potential protein-protein interactions with PlsX and other membrane-associated proteins

    • Studying the coordination between phospholipid synthesis and cell division machinery

What is known about the evolutionary conservation of plsY across Campylobacter species and how might this inform pathogenicity studies?

Evolutionary analysis of plsY across Campylobacter species reveals important insights into bacterial adaptation and pathogenicity:

  • Conservation patterns:

    • The plsY gene appears to be conserved across Campylobacter species, including C. jejuni, C. coli, C. lari, and C. upsaliensis

    • Comparative genomic analyses show that while the core enzymatic function is preserved, specific sequence variations exist that may correlate with host specificity and virulence potential

    • Unlike some Bacillus species that possess multiple plsY homologs, most Campylobacter species contain only a single plsY gene

  • Structural and functional implications:

    • Sequence variations in plsY may influence substrate specificity and enzyme kinetics

    • Changes in acyl chain preference could alter membrane composition, affecting bacterial survival in different host environments

    • Membrane fluidity differences resulting from plsY variations might impact antibiotic resistance profiles between species

  • Pathogenicity correlations:

    • Phospholipid composition affects membrane properties that influence host-pathogen interactions

    • Variations in plsY may contribute to differences in colonization capability, immune evasion, and survival in diverse host niches

    • The enzyme's role in membrane biosynthesis connects it to virulence mechanisms dependent on membrane integrity, such as adhesion, invasion, and secretion systems

  • Research applications in pathogenicity:

    • Targeted mutagenesis studies comparing plsY variants between pathogenic and non-pathogenic strains

    • Investigation of plsY expression patterns during host infection

    • Analysis of membrane phospholipid compositions across species in relation to virulence potential

    • Development of specific inhibitors targeting plsY as potential antimicrobial agents

This evolutionary understanding of plsY can inform the design of experiments investigating the role of membrane composition in pathogenicity and host adaptation across Campylobacter species.

How does genetic manipulation of plsY affect bacterial membrane composition and cellular physiology?

Genetic manipulation of plsY can have profound effects on bacterial membrane composition and cellular physiology, offering valuable insights for research:

  • Effects on phospholipid composition:

    • Reduced plsY expression typically results in altered ratios of major phospholipids (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin)

    • Changes in acyl chain composition may occur due to substrate accumulation in the fatty acid synthesis pathway

    • Conditional knockdown studies in related bacteria have shown accumulation of abnormally long-chain acyl-ACPs due to continued elongation by fatty acid synthesis enzymes

  • Physiological consequences:

    • Membrane fluidity alterations affecting passive and active transport functions

    • Changes in membrane potential and proton gradients impacting energy metabolism

    • Modified susceptibility to antimicrobial agents that target membrane integrity

    • Altered cell morphology due to imbalances in membrane expansion

    • Growth rate reductions correlating with phospholipid synthesis limitations

  • Regulatory feedback mechanisms:

    • PlsY manipulation triggers compensatory responses in fatty acid synthesis pathways

    • Altered expression of other phospholipid biosynthetic enzymes to maintain homeostasis

    • Activation of stress response pathways related to membrane integrity

  • Experimental approaches for manipulation:

    • Site-directed mutagenesis targeting catalytic residues

    • Promoter replacements with inducible systems for titration of expression levels

    • Protein destabilization approaches using degron fusion systems

    • Heterologous expression of plsY variants from different bacterial species

Manipulation StrategyPotential EffectsResearch Applications
Reduced expressionDecreased phospholipid synthesis, aberrant membrane compositionMembrane stress response studies
OverexpressionPotential imbalance in phospholipid/protein ratio, altered fatty acid utilizationMembrane expansion dynamics
Catalytic site mutationsSelective reduction in activity, substrate specificity changesStructure-function relationship studies
Chimeric constructsAltered acyl chain preference, modified membrane propertiesHost adaptation mechanisms

How does Campylobacter lari plsY compare to homologous enzymes in other pathogenic bacteria?

Comparative analysis of Campylobacter lari plsY with homologs in other pathogenic bacteria reveals significant insights into functional conservation and specialization:

  • Sequence and structure comparisons:

    • Campylobacter lari plsY shares core catalytic motifs with homologs from diverse bacterial species

    • The enzyme belongs to the widespread PlsY family (pfam02660/COG0344) containing the domain of unknown function, DUF205

    • While the core membrane topology (five membrane-spanning segments) appears conserved, variations in loop regions and substrate-binding domains exist between species

    • Sequence identity typically ranges from 30-45% between Campylobacter and other genera, with higher conservation (60-80%) within the Campylobacter genus

  • Substrate specificity differences:

    • Unlike PlsB from Escherichia coli that can use both acyl-ACP and acyl-CoA as acyl donors, Campylobacter lari plsY exclusively utilizes acyl-phosphate

    • Similar to Gram-positive bacteria like Streptococcus pneumoniae and Bacillus subtilis, Campylobacter plsY likely cannot utilize acyl-CoA

    • Acyl chain length preferences may vary between species, reflecting adaptation to different membrane requirements

  • Genetic context and regulation:

    • In many bacteria, plsY is co-regulated with other phospholipid biosynthesis genes

    • Regulatory mechanisms controlling plsY expression may differ between pathogens, reflecting their various ecological niches

    • The genetic linkage between plsY and plsX (encoding the acyl-ACP:phosphate transacylase) varies across bacterial species

  • Pathogenicity implications:

    • Membrane composition differences resulting from plsY variants may contribute to pathogen-specific host interactions

    • Variations in lipid A acylation patterns mediated by plsY activity can affect LPS structure and immunogenicity

    • The species-specific variations in glycerophospholipid metabolism may contribute to different virulence capabilities observed across Campylobacter species

What research gaps exist in understanding the relationship between plsY activity and Campylobacter virulence?

Despite progress in understanding Campylobacter lari plsY, several critical research gaps remain in elucidating its relationship to bacterial virulence:

  • Structure-function relationship gaps:

    • High-resolution structural data for Campylobacter plsY is lacking, hampering rational drug design efforts

    • The precise catalytic mechanism and rate-limiting steps specific to Campylobacter plsY remain undefined

    • The molecular basis for acyl chain selectivity and its impact on membrane composition is poorly characterized

  • Regulatory network uncertainties:

    • How environmental signals modulate plsY expression during host colonization is largely unknown

    • The coordination between plsY activity and virulence factor expression has not been thoroughly investigated

    • Potential protein-protein interactions between plsY and other membrane-associated virulence factors require exploration

  • Host-pathogen interaction questions:

    • The impact of plsY-mediated membrane composition changes on host immune recognition remains unclear

    • How plsY activity might influence Campylobacter survival in different host niches (avian vs. mammalian hosts) needs investigation

    • The potential role of plsY in biofilm formation and environmental persistence requires further study

  • Methodological challenges:

    • Development of specific inhibitors for Campylobacter plsY to evaluate its essentiality in vivo

    • Creation of conditional mutants to study the effects of plsY depletion on pathogenesis in animal models

    • Techniques to measure plsY activity in situ during different stages of infection

  • Therapeutic potential uncertainties:

    • The druggability of Campylobacter plsY as an antimicrobial target needs evaluation

    • Potential for cross-species inhibitors targeting conserved features of plsY enzymes

    • Assessment of resistance development potential for plsY-targeted therapeutics

Research addressing these gaps could significantly advance our understanding of Campylobacter pathogenesis and potentially identify novel therapeutic approaches .

How might contradictions in published data about Campylobacter membrane proteins be reconciled through plsY research?

The study of Campylobacter lari plsY offers unique opportunities to reconcile contradictions in published data regarding Campylobacter membrane proteins through several methodological approaches:

What are the most effective protein tagging strategies for purification and functional studies of Campylobacter lari plsY?

Optimizing protein tagging for Campylobacter lari plsY requires careful consideration of the enzyme's membrane-integrated nature and functional requirements:

  • N-terminal tagging considerations:

    • Preferred location for tags since the N-terminus is likely cytoplasmic based on membrane topology predictions

    • Short tags (His₆, FLAG, Strep-II) minimize interference with membrane insertion

    • Inclusion of flexible linkers (GGGGSGGGGS) can reduce steric hindrance

    • TEV or PreScission protease cleavage sites allow tag removal post-purification

  • C-terminal tagging limitations:

    • May interfere with proper membrane insertion or protein folding

    • If used, should include longer linker sequences to distance the tag from functional domains

    • Fluorescent protein fusions at this position may report on proper folding and localization

  • Internal tagging options:

    • Insertion of tags in predicted loop regions between membrane-spanning segments

    • Requires careful structural analysis to identify permissive insertion sites

    • Split-GFP or split-luciferase approaches can minimize structural disruption

  • Tag selection for specific applications:

    • Purification: His₆/His₁₀, Strep-II, or FLAG tags provide efficient IMAC or affinity purification

    • Localization studies: mCherry, GFP, or other fluorescent proteins (preferably at N-terminus)

    • Interaction studies: BirA, APEX2, or HaloTag for proximity labeling experiments

    • Stability assessment: Degron tags for controlled degradation studies

  • Validation approaches:

    • Activity assays comparing native and tagged versions

    • Western blot analysis to confirm full-length expression

    • Membrane fractionation to verify proper localization

    • Mass spectrometry to confirm post-translational modifications

Tag TypePositionAdvantagesLimitationsRecommended Applications
His₆N-terminalEfficient purification, minimal sizePotential metal ion interferencePurification, pull-downs
FLAGN-terminalHigh-specificity antibodies, mild elutionHigher cost for detectionCo-immunoprecipitation
GFPN-terminalDirect visualization, folding reporterLarge size may affect functionLocalization, expression
Strep-IIN-terminalGentle purification conditionsLower capacity than His-tagFunctional complex isolation
HaloTagN-terminalCovalent labeling optionsLarger sizeImaging, pull-downs

How can structural analysis techniques be optimized for membrane-integrated proteins like Campylobacter lari plsY?

Structural analysis of membrane-integrated proteins like Campylobacter lari plsY presents unique challenges requiring specialized approaches:

These optimized approaches can overcome the inherent challenges of membrane protein structural biology to generate valuable insights into plsY function.

What potential exists for developing plsY-targeted antimicrobials against Campylobacter infections?

The development of plsY-targeted antimicrobials against Campylobacter infections represents a promising frontier in antibacterial research:

  • Target validation considerations:

    • PlsY is essential for phospholipid biosynthesis and bacterial viability, making it an attractive target

    • The lack of human homologs reduces the risk of off-target effects

    • The conserved nature of plsY across Campylobacter species suggests broad-spectrum potential within this genus

    • Selective inhibition may be possible due to structural differences from mammalian acyltransferases

  • Inhibitor design strategies:

    • Substrate analogs: Development of acyl-phosphate mimetics that competitively inhibit the enzyme

    • Transition state analogs: Design of molecules mimicking the reaction transition state for tight binding

    • Allosteric inhibitors: Targeting non-catalytic sites that regulate enzyme activity

    • Membrane-disrupting agents: Compounds that interfere with plsY's interaction with the lipid bilayer

  • High-throughput screening approaches:

    • Development of in vitro assays measuring lysophosphatidic acid formation

    • Whole-cell screens using Campylobacter strains with modified plsY expression

    • Fragment-based screens to identify chemical scaffolds with activity against plsY

    • Virtual screening against homology models or solved structures

  • Delivery system considerations:

    • Designing inhibitors with appropriate lipophilicity to penetrate bacterial membranes

    • Targeted delivery systems to increase local concentration at infection sites

    • Prodrug approaches to improve pharmacokinetic properties

  • Resistance development assessment:

    • Mutation frequency analysis for plsY target modifications

    • Evaluation of potential bypass mechanisms or efflux-mediated resistance

    • Combination therapy approaches to reduce resistance development potential

The development pipeline should include medicinal chemistry optimization, detailed pharmacokinetic/pharmacodynamic studies, and in vivo efficacy testing in relevant animal models of Campylobacter infection.

How might systems biology approaches integrate plsY function into broader models of Campylobacter metabolism and virulence?

Integrating plsY function into systems biology frameworks offers powerful approaches to understand Campylobacter metabolism and virulence holistically:

  • Multi-omics integration strategies:

    • Genomics: Comparative analysis of plsY sequence variations across Campylobacter strains and correlation with virulence phenotypes

    • Transcriptomics: RNA-seq analysis of gene expression networks under plsY modulation

    • Proteomics: Global protein expression profiling following plsY perturbation

    • Lipidomics: Comprehensive membrane lipid profiling under different growth conditions and plsY expression levels

    • Metabolomics: Tracking metabolic flux through phospholipid biosynthesis pathways

  • Network modeling approaches:

    • Construction of genome-scale metabolic models incorporating plsY-dependent reactions

    • Flux balance analysis to predict the impact of plsY inhibition on cellular metabolism

    • Regulatory network reconstruction to identify transcription factors controlling plsY expression

    • Protein-protein interaction networks to map plsY's functional associations

  • Host-pathogen interaction modeling:

    • Agent-based models simulating Campylobacter colonization with variable plsY activity

    • In silico prediction of membrane composition effects on host immune recognition

    • Integration of transcriptomic data from both host and pathogen during infection

  • Experimental validation strategies:

    • Creation of reporter strains with fluorescent proteins linked to plsY expression

    • CRISPR interference approaches for titratable control of plsY expression

    • Transposon sequencing (Tn-seq) to identify genetic interactions with plsY

    • Isotope labeling experiments to trace carbon flow through phospholipid synthesis

  • Predictive applications:

    • Identification of environmental conditions affecting plsY regulation

    • Prediction of strain-specific antibiotic susceptibilities based on membrane composition

    • In silico screening of potential inhibitor effects on global metabolism

    • Modeling evolutionary trajectories under selective pressure on membrane composition

This systems biology framework would provide unprecedented insights into how plsY functions within the broader context of Campylobacter physiology and pathogenesis .

What novel research techniques could advance our understanding of plsY's role in bacterial adaptation to diverse environments?

Advancing our understanding of plsY's role in bacterial adaptation requires innovative research techniques that can capture dynamic changes in enzyme function across environmental conditions:

  • Single-cell analysis technologies:

    • Single-cell RNA-seq: To detect heterogeneity in plsY expression within bacterial populations

    • Microfluidic devices: For real-time monitoring of individual bacterial responses to environmental changes

    • Single-cell metabolomics: To detect cell-to-cell variation in phospholipid composition

    • FISH-based approaches: To visualize plsY transcription in different microenvironments

  • Real-time monitoring systems:

    • Fluorescent biosensors: FRET-based sensors reporting on plsY activity or lipid composition changes

    • Surface plasmon resonance: For detecting environmental modulation of plsY-substrate interactions

    • Isothermal calorimetry: To measure thermodynamic parameters under varying conditions

    • Electrochemical detection: For continuous monitoring of lipid synthesis rates

  • Advanced genetic manipulation approaches:

    • CRISPR interference: For titratable repression of plsY to establish minimum threshold levels

    • Optogenetic control: Light-regulated expression systems for spatial and temporal control of plsY

    • In vivo directed evolution: To evolve plsY variants adapted to specific environmental conditions

    • Recombineering: For introducing subtle mutations to test specific hypotheses about plsY function

  • Environmental simulation techniques:

    • Bioreactor systems: Mimicking host intestinal conditions with controlled parameters

    • Artificial gut models: For studying plsY activity during passage through simulated digestive tracts

    • Temperature/pH/oxygen gradient devices: To analyze adaptation across environmental transitions

    • Host cell co-culture systems: For examining plsY regulation during host cell interactions

  • Advanced imaging technologies:

    • Super-resolution microscopy: For subcellular localization of plsY in relation to other membrane components

    • Correlative light and electron microscopy: To connect plsY localization with membrane ultrastructure

    • Raman microscopy: For label-free chemical imaging of membrane composition changes

    • Atomic force microscopy: To detect mechanical property changes in membranes due to altered phospholipid composition

These novel techniques would provide unprecedented insights into how plsY activity responds to and enables adaptation across the diverse environments encountered by Campylobacter species, from avian reservoirs to human hosts, and during transmission through various environmental matrices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.