Recombinant Campylobacter lari Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview and Biological Role

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of cysteine in prolipoproteins, forming mature triacylated lipoproteins . In Campylobacter lari, this modification is vital for:

  • Outer membrane integrity

  • Virulence factor localization

  • Host-pathogen interactions .

Studies in Escherichia coli confirm that Lgt depletion leads to cell lysis, DNA leakage, and increased antibiotic sensitivity, underscoring its essentiality .

Conserved Domains and Critical Residues

  • Transmembrane Topology: Lgt contains seven transmembrane helices, with catalytic residues facing the periplasm .

  • Signature Motif: A conserved Lgt motif (e.g., Y26, N146, G154 in E. coli) is critical for enzymatic activity . Mutations in these residues abolish function .

  • Sequence Homology: C. lari Lgt shares <25% identity with E. coli Lgt but retains similar hydropathic profiles and pI (~10.4) .

Catalytic Mechanism

Lgt transfers diacylglycerol via a two-step process:

  1. Binding of phosphatidylglycerol and prolipoprotein.

  2. Nucleophilic attack by the prolipoprotein’s cysteine thiol .

Antimicrobial Drug Development

  • Lgt is a validated target for novel antibiotics. Inhibitors (e.g., macrocycles G2823/G2824) disrupt lipoprotein maturation, causing outer membrane blebbing and cell death .

  • C. lari Lgt’s recombinant form enables high-throughput screening for species-specific inhibitors .

Pathogenicity Studies

  • Lipoproteins modified by Lgt contribute to C. lari’s resilience in marine environments and zoonotic transmission .

  • Knockout studies in related Campylobacter species reveal impaired adhesion, invasion, and biofilm formation .

Comparative Analysis of Lgt Across Species

SpeciesIdentity with C. lari LgtEssentialityNotable Features
Escherichia coli~24%Essential Seven transmembrane domains; pI ~10.4
Staphylococcus aureus~24%Non-essentialShorter by 12 residues; similar pI
Campylobacter jejuniNot reportedPresumed essentialLinked to chemotaxis and host colonization

Challenges and Future Directions

  • Species-Specific Variations: Low sequence homology complicates cross-species inhibitor design .

  • Thermostability: C. lari Lgt’s stability at marine temperatures (~15–25°C) requires further characterization .

  • Clinical Relevance: Links between Lgt activity and C. lari pathogenicity in humans remain underexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
lgt; Cla_0332; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Target Names
lgt
Target Protein Sequence
MEFWQNIYVNFDVVAFEIFGLKVHWYGIMYVLALLVALMVAKYYAIKDNMGISKAMLDSY FIWVEIGVILGARIGYILIYDAHTLWYLTHPWQIFNPFYNGEFVGIRGMSYHGAVVGFLI ATYAFCKKNKQNLWKYLDLVAISVPCGYIFGRIGNFLNQELFGRATEVPWGIYVDGILRH PSQLYEAFLEGFIVFIILLLIKKYKKYNGELIAYYTILYALARFVCEFFREPDFGIGFVA FGMSMGQILSLLMFLLGLFLSFYLRNIKKNL
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Campylobacter lari prolipoprotein diacylglyceryl transferase and what is its role in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. In Campylobacter lari, as in other Gram-negative bacteria, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in the lipobox motif of prolipoproteins. This post-translational modification is essential for proper lipoprotein anchoring to bacterial membranes. The reaction results in the formation of a thioether bond and the release of glycerol phosphate as a byproduct . This modification is crucial for the stability and functionality of numerous outer membrane proteins that play vital roles in bacterial growth, pathogenesis, and membrane integrity. Inhibition or depletion of Lgt has been shown to lead to outer membrane permeabilization and increased sensitivity to serum killing and antibiotics in other Gram-negative bacteria, suggesting similar importance in C. lari .

How is the lgt gene structured and characterized in Campylobacter lari?

The lgt gene in Campylobacter lari encodes the prolipoprotein diacylglyceryl transferase enzyme. While specific sequence details for C. lari lgt are not fully elaborated in the provided sources, comparative genomic analyses of C. lari isolates reveal significant genetic diversity across different strains. Within the Campylobacter lari group, whole-genome sequence-derived multilocus sequence typing (MLST) has identified 97 sequence types (STs) among 158 isolates, with 60 novel STs . This genetic diversity extends to virulence-related loci, which show high prevalence (76.8% to 98.4% per isolate) in C. lari subspecies lari (Cll) isolates . These findings suggest that different C. lari strains may possess variants of the lgt gene, potentially affecting protein function and experimental approaches when working with recombinant forms of the enzyme.

How does C. lari Lgt compare structurally and functionally to Lgt proteins from other bacterial species?

While C. lari Lgt-specific comparative data is limited in the available sources, insights can be drawn from other bacterial Lgt comparisons. Studies of Lgt across phylogenetically distant bacterial species have revealed important structural and functional similarities. For example, Staphylococcus aureus Lgt shows 24% identity and 47% similarity with Escherichia coli, Salmonella typhimurium, and Haemophilus influenzae Lgt proteins . Similar patterns of conservation may exist with C. lari Lgt.

Functionally, all Lgt enzymes catalyze the same reaction: transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins. The biochemical activity of Lgt can be measured in vitro by detecting glycerol phosphate release using the same methodology across species . As with other Lgt proteins, C. lari Lgt likely possesses a hydropathic profile consistent with its membrane-associated function, similar to that observed with the E. coli enzyme which has a predicted pI of approximately 10.4 .

What expression systems are most effective for producing recombinant C. lari Lgt?

Based on experimental approaches used for similar proteins, several expression systems can be considered for recombinant C. lari Lgt production. E. coli is the most commonly used bacterial host for expressing recombinant proteins, including those from Campylobacter species . For functional studies of membrane proteins like Lgt, E. coli expression systems that allow for membrane integration would be preferable.

The methodological approach would typically include:

  • Gene cloning: PCR amplification of the C. lari lgt gene and insertion into a suitable expression vector

  • Host transformation: Introduction of the expression construct into an E. coli host strain optimized for membrane protein expression

  • Protein expression: Induction of protein production under controlled conditions (temperature, media, induction time)

  • Membrane fraction isolation: Careful separation of membrane fractions containing the recombinant protein

  • Protein purification: Detergent solubilization and affinity chromatography using appropriate tag systems

Alternative expression systems might include yeast, baculovirus, or mammalian cell systems, particularly when protein folding or post-translational modifications are concerns . Each system offers distinct advantages and challenges for membrane protein expression.

How does heat stress affect the expression and activity of C. lari Lgt in experimental systems?

Heat stress response in Campylobacter species is characterized by complex transcriptomic changes. In C. lari, exposure to elevated temperatures (46°C) induces significant alterations in gene expression patterns . While direct data on lgt expression under heat stress is not provided in the sources, research on other Campylobacter species suggests that heat shock proteins like ClpB, GrpE, DnaK, GroEL, GroES, CbpA, and DnaJ play crucial roles in the heat stress response .

For experimental design considerations when working with recombinant C. lari Lgt, researchers should note that C. lari shows distinct expression patterns compared to other Campylobacter species under heat stress conditions . This suggests that optimal expression and activity conditions for recombinant C. lari Lgt might differ from those established for other Campylobacter proteins. Temperature optimization studies should be conducted to determine the thermal stability profile of the recombinant enzyme, with particular attention to:

  • Effect of growth temperature on expression levels

  • Thermal stability of the purified enzyme

  • Activity assays across a temperature range

  • Influence of stabilizing agents on thermal tolerance

Such characterization would enable more robust experimental design for functional studies of the enzyme.

What methods can be employed to assess the enzymatic activity of recombinant C. lari Lgt?

Assessment of C. lari Lgt enzymatic activity can be approached using established methodologies for Lgt from other bacterial species. A reliable assay involves measuring the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . The detailed methodological approach includes:

  • Substrate preparation:

    • Phosphatidylglycerol (PG) as the diacylglyceryl donor

    • Synthetic peptide substrate derived from a C. lari lipoprotein containing the conserved cysteine residue (similar to the Pal-IAAC peptide used for E. coli Lgt, where C is the conserved cysteine that is modified)

  • Reaction conditions:

    • Buffer optimization: pH, ionic strength, and potential metal cofactor requirements

    • Temperature control: typically at physiological temperature for C. lari (approximately 37-42°C)

    • Incubation time optimization

  • Product detection:

    • Quantification of released glycerol-1-phosphate (G1P) using colorimetric, fluorometric, or coupled enzyme assays

    • Alternative approaches could include mass spectrometry to detect the modified peptide product or radiolabeled substrates for increased sensitivity

  • Data analysis:

    • Determination of kinetic parameters (Km, Vmax)

    • Assessment of the effects of potential inhibitors

    • Comparison with Lgt activity from other bacterial species

How can genomic diversity within C. lari strains impact recombinant Lgt studies?

The significant genomic diversity observed within Campylobacter lari isolates has important implications for recombinant Lgt studies. Research indicates that C. lari isolates exhibit high genetic diversity, with 97 different sequence types (STs) identified among 158 isolates studied, including 60 novel STs . Additionally, C. lari can be divided into different subspecies, including C. lari subsp. lari (Cll), C. lari subsp. concheus (Clc), and urease-positive thermotolerant Campylobacter (UPTC) .

This genetic diversity has several key implications for recombinant Lgt research:

  • Selection of representative strain:
    Researchers must carefully select and document the specific C. lari strain used as the source for the lgt gene, as sequence variations could affect protein structure, function, and antigenicity.

  • Comparative genomic analysis:
    Before cloning the lgt gene, performing comparative sequence analysis among different C. lari strains would help identify conserved regions and functional domains critical for enzymatic activity.

  • Functional validation:
    Activity assays should be conducted to confirm that the recombinant Lgt retains functionality comparable to the native enzyme from the source strain.

  • Host-specific adaptations:
    C. lari strains from different hosts (human, domestic animal, waterbird, or environment) show different subspecies distributions , which might reflect adaptations in membrane proteins including Lgt to different ecological niches.

Source of IsolatesC. lari subsp. lari (%)C. lari subsp. concheus (%)C. lari UPTC (%)Other Campylobacter spp. (%)
Human79.33.7017.0
Domestic Animal71.428.600
Food91.78.300
Environment22.63.241.932.3
Waterbird26.315.810.547.4

Table 1: Distribution of C. lari subspecies by source (derived from data in source )

What are potential inhibitors of C. lari Lgt and how can they be identified?

While specific inhibitors of C. lari Lgt are not directly described in the provided sources, recent research has identified the first inhibitors of E. coli Lgt that potently inhibit its biochemical activity in vitro and are bactericidal against wild-type bacteria . These findings provide a valuable starting point for developing and identifying inhibitors of C. lari Lgt.

A comprehensive approach to identifying C. lari Lgt inhibitors would include:

  • High-throughput screening:

    • Adaptation of the established E. coli Lgt activity assay that measures glycerol phosphate release

    • Screening of compound libraries against recombinant C. lari Lgt

    • Counter-screening to eliminate compounds with non-specific effects

  • Structure-based design:

    • Homology modeling of C. lari Lgt based on available bacterial Lgt structures

    • In silico docking of potential inhibitor molecules

    • Rational design of inhibitors targeting the active site or substrate binding pocket

  • Lead optimization:

    • Synthesis of analogs of identified hit compounds

    • Structure-activity relationship (SAR) studies

    • Assessment of antibacterial activity against wild-type C. lari strains

  • Evaluation of inhibitor specificity:

    • Testing against Lgt from other bacterial species

    • Assessment of off-target effects

    • Determination of the mechanism of inhibition

  • Resistance potential:

    • Investigation of whether deletion of major outer membrane lipoproteins can provide resistance to Lgt inhibitors, as has been studied for E. coli

    • Genomic analysis to identify potential resistance mechanisms

The validation of Lgt as a druggable antibacterial target in E. coli suggests that C. lari Lgt could similarly be targeted for antimicrobial development .

How can structural biology approaches enhance our understanding of C. lari Lgt?

Structural biology approaches offer powerful tools for understanding the molecular details of C. lari Lgt function. While no specific structural data for C. lari Lgt appears in the provided sources, several methodological approaches could be employed:

  • X-ray crystallography:

    • Expression and purification of C. lari Lgt with appropriate detergents for membrane protein stabilization

    • Crystallization screening using vapor diffusion methods, lipidic cubic phase, or other membrane protein-specific approaches

    • Structure determination and refinement

    • Comparison with available structures of Lgt from other bacterial species

  • Cryo-electron microscopy:

    • Sample preparation of purified C. lari Lgt in appropriate membrane mimetics (nanodiscs, amphipols)

    • Single-particle analysis and 3D reconstruction

    • Determination of protein structure in a near-native environment

  • NMR spectroscopy:

    • Isotopic labeling of recombinant C. lari Lgt

    • Solution or solid-state NMR studies

    • Dynamics analysis and ligand binding studies

  • Molecular dynamics simulations:

    • Development of computational models based on homology or experimentally determined structures

    • Simulation of protein dynamics in a membrane environment

    • Investigation of substrate binding and catalytic mechanism

  • Structure-guided mutagenesis:

    • Identification of critical residues for catalysis and substrate binding

    • Site-directed mutagenesis of these residues

    • Functional analysis of mutant enzymes

The structure-function relationship studies conducted with other bacterial Lgt enzymes, including analysis of primary structures and specific chemical modifications , provide a template for similar investigations with C. lari Lgt.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.