Recombinant Candida albicans 3-ketodihydrosphingosine reductase TSC10 (TSC10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
KSR1; TSC10; CAALFM_CR07380CA; CaO19.13550; CaO19.6131; 3-ketodihydrosphingosine reductase TSC10; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
Target Protein Sequence
MWFSKTNFPVEGKTALIVGASQGIGVNLAERLYEKNCSTILVARTESKLQHQIQNIKEKY PESSAKISYAVADVSNYDECTRLWQTIHPADPDILFCCAGSSIPKLFQDLTKVDIESGID INYKTVINVVHTGFKHALSNNTDNLEPHNFKKRSVVLFSSVVSFFPFIGYSQYAPMKSAI ESLSIILRRELSPYNYRVTCVFPGNFQSEGFEEEQKTKPDITKKIEGPSNPIPGDECARL IIDQLDKGYDSITTDFIGWFLGCSVLGISSP
Uniprot No.

Target Background

Function
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function of 3-ketodihydrosphingosine reductase (TSC10) in Candida albicans?

3-Ketodihydrosphingosine reductase (TSC10/KSR1) catalyzes the second step in sphingolipid biosynthesis, reducing 3-ketodihydrosphingosine (3KDS) to dihydrosphingosine. This enzyme is essential for the production of functional sphingolipids, which are vital components of fungal cell membranes. The enzyme operates downstream of serine palmitoyltransferase (SPT), which catalyzes the rate-limiting condensation of L-serine and palmitoyl-CoA to form 3KDS . Functionally, TSC10 represents a critical node in sphingolipid metabolism that influences membrane integrity, cellular signaling, and stress responses in C. albicans.

How is TSC10 genetically encoded in Candida albicans?

In C. albicans, the gene encoding 3-ketodihydrosphingosine reductase is known as KSR1. Research has shown that KSR1 contains heterozygous nucleotides in reference isolates such as SC5314, where one allele encodes an early stop codon resulting in a truncated protein lacking the membrane localization domain . This genetic heterozygosity appears to play a significant role in the fungus's adaptability and potential for developing drug resistance. The gene is located on chromosome R in C. albicans, and loss of heterozygosity (LOH) events affecting this gene have been associated with fluconazole resistance development .

What experimental approaches are used to study TSC10 expression levels in C. albicans?

Several methodological approaches can be employed to study TSC10 expression:

  • Quantitative PCR (qPCR): For measuring transcript levels of TSC10/KSR1 under different conditions

  • Western blotting: Using specific antibodies against TSC10 to quantify protein expression

  • Reporter gene assays: Fusing the TSC10 promoter to reporter genes like GFP or luciferase

  • RNA sequencing: For genome-wide expression analysis including TSC10 regulation

When studying expression patterns, researchers should include appropriate housekeeping gene controls and validate findings across multiple C. albicans strains, particularly when comparing azole-susceptible and azole-resistant isolates .

What are the optimal conditions for recombinant expression of C. albicans TSC10?

Recombinant expression of C. albicans TSC10 can be achieved through several expression systems, each with specific optimization requirements:

Bacterial Expression (E. coli):

  • Vector selection: pGEX vectors (such as pGEX-6P-2) can be used for GST-tagged protein expression, similar to the approach used for other C. albicans proteins

  • Induction conditions: 0.1-1.0 mM IPTG at 16-25°C for 4-16 hours typically yields better folding for membrane-associated proteins

  • Codon optimization: Essential due to codon usage differences between E. coli and C. albicans

  • Solubility enhancement: Expression as fusion proteins with solubility tags (MBP, SUMO, or GST)

Yeast Expression (S. cerevisiae or P. pastoris):

  • Recommended for better post-translational modifications

  • Vectors containing GAL1 or AOX1 promoters for inducible expression

  • Growth in 2% galactose (S. cerevisiae) or methanol (P. pastoris) for induction

When expressing membrane-associated proteins like TSC10, optimization of detergent conditions during extraction and purification is critical for maintaining protein functionality.

What purification strategies yield the highest purity and activity for recombinant TSC10?

A multi-step purification strategy is recommended for obtaining high-purity, active TSC10:

  • Affinity Chromatography:

    • For His-tagged constructs: Ni-NTA resin with imidazole gradient elution

    • For GST-tagged constructs: Glutathione sepharose with reduced glutathione elution

  • Ion Exchange Chromatography:

    • Anion exchange using Q-Sepharose at pH 8.0 (adjust based on protein pI)

    • Salt gradient elution (0-500 mM NaCl)

  • Size Exclusion Chromatography:

    • Final polishing step to separate monomeric protein from aggregates

    • Superdex 200 column in buffer containing low concentrations of stabilizing detergent

For membrane-associated proteins like TSC10, incorporating 0.01-0.05% mild detergents (DDM, CHAPS, or Triton X-100) in all buffers helps maintain protein solubility and activity. Purification should be performed at 4°C with protease inhibitors to prevent degradation.

How can the functional activity of purified recombinant TSC10 be assessed?

The enzymatic activity of purified recombinant TSC10 can be evaluated through several complementary approaches:

  • Spectrophotometric Assays:

    • Monitoring NAD(P)H oxidation at 340 nm, as TSC10 catalyzes a reductive reaction using NAD(P)H as a cofactor

    • Reaction conditions: 50 mM phosphate buffer (pH 7.5), 100-200 μM 3KDS substrate, 200 μM NAD(P)H, 1-10 μg purified enzyme

  • HPLC-ESI-MS/MS Analysis:

    • Direct quantification of substrate (3KDS) consumption and product (dihydrosphingosine) formation

    • This approach provides definitive evidence of catalytic activity and allows kinetic parameter determination

    • Sample preparation typically involves lipid extraction followed by chromatographic separation

  • Complementation Assays:

    • Expression of recombinant TSC10 in S. cerevisiae or C. albicans TSC10-deficient strains

    • Rescue of growth defects or sphingolipid biosynthesis confirms functional activity

Enzyme kinetic parameters (Km, Vmax, kcat) should be determined under varying substrate and cofactor concentrations to fully characterize the recombinant enzyme.

How does TSC10/KSR1 contribute to azole resistance in Candida albicans?

TSC10/KSR1 has been implicated in azole resistance through several mechanisms:

  • Loss of Heterozygosity (LOH) Events:

    • Research has identified specific LOH events (~711 bp) in KSR1 that contribute to fluconazole resistance

    • These LOH events lead to homozygosity for functional alleles rather than creating homozygous early stop codons

    • When combined with chromosome 4 copy number variations (CNV), these KSR1 LOH events can increase fluconazole MIC50 by over 500-fold compared to susceptible isolates

  • Membrane Composition Alterations:

    • As a key enzyme in sphingolipid biosynthesis, altered TSC10 activity affects membrane composition

    • Modified sphingolipid content can alter membrane fluidity and permeability to azole drugs

    • This potentially reduces intracellular azole accumulation and effectiveness

  • Synergistic Effects with Efflux Transporters:

    • TSC10 modifications may work additively with upregulation of CDR1 and CDR2 drug efflux transporters, which are known to contribute to azole resistance

The step-wise evolution of resistance involving TSC10/KSR1 demonstrates how C. albicans can rapidly adapt to antifungal pressure through sequential genetic alterations .

Distinguishing TSC10-mediated resistance from other mechanisms requires a multi-faceted approach:

  • Whole Genome Sequencing:

    • Identifying specific LOH events in the KSR1/TSC10 region (e.g., the ~711 bp LOH on chromosome R)

    • Detecting copy number variations that might work synergistically with TSC10 alterations

    • Analyzing allele frequencies to track evolutionary trajectories

  • Functional Genomics:

    • CRISPR-Cas9 gene editing to correct or introduce specific TSC10 mutations

    • Analyzing resulting phenotypes to establish causation rather than correlation

  • Transcriptomics/Proteomics:

    • RNA-seq to determine if other resistance genes (e.g., CDR1, CDR2, ERG11) are upregulated

    • Proteomics to measure TSC10 protein levels and modifications

  • Biochemical Characterization:

    • Sphingolipid profiling using HPLC-ESI-MS/MS to detect alterations in sphingolipid metabolism

    • Membrane fluidity assessments to identify TSC10-associated changes in membrane properties

  • Drug Accumulation Assays:

    • Measuring intracellular azole concentrations to distinguish between reduced uptake, increased efflux, or target modification mechanisms

This comprehensive approach allows researchers to attribute resistance phenotypes to specific mechanisms and understand their relative contributions in clinical isolates.

How can recombinant TSC10 be utilized for developing diagnostic tools for invasive candidiasis?

Recombinant TSC10 shows promise as a component in diagnostic approaches for invasive candidiasis:

  • Antibody-Based Detection Systems:

    • Development of anti-TSC10 antibodies for immunoassays

    • ELISA-based detection of TSC10 in patient samples as a biomarker of infection

    • Recombinant TSC10 can serve as a standardized antigen in these assays, improving reproducibility compared to crude fungal extracts

  • Serological Diagnosis:

    • Detection of anti-TSC10 antibodies in patient sera

    • Similar to other Candida antigens, patient antibody responses to TSC10 could indicate invasive infection

    • Recombinant TSC10-based serological tests may offer improved specificity over traditional methods

  • Multiplex Antigen Panels:

    • Combining TSC10 with other recombinant Candida antigens (e.g., Hwp1, enolase) in diagnostic panels

    • This approach can increase sensitivity, as antibody kinetics vary between patients and antigens

    • Such panels may achieve sensitivity >90% and specificity >80% for invasive candidiasis diagnosis

The use of well-defined recombinant antigens like TSC10 offers advantages over crude antigenic fungal extracts, including higher reproducibility, reduced cross-reactivity, and potential for automation in clinical laboratory settings .

What methodological approaches are used to evaluate TSC10 as a potential antifungal drug target?

Several methodological approaches can assess TSC10's potential as an antifungal drug target:

  • Target Validation Studies:

    • Gene deletion/knockdown experiments to confirm essentiality

    • Conditional expression systems to determine if partial inhibition is sufficient for antifungal activity

    • Comparison of phenotypes across multiple Candida species and strains

  • High-Throughput Screening:

    • Development of enzymatic assays suitable for screening compound libraries

    • Primary screens using spectrophotometric NAD(P)H oxidation assays

    • Secondary confirmation using HPLC-ESI-MS/MS to verify inhibition of 3KDS reduction

  • Structure-Based Drug Design:

    • X-ray crystallography or cryo-EM studies of TSC10 structure

    • In silico docking and molecular dynamics simulations

    • Rational design of inhibitors targeting the active site or allosteric sites

  • Medicinal Chemistry Optimization:

    • Structure-activity relationship studies of lead compounds

    • Optimization for selectivity against human homologs

    • Enhancement of pharmacokinetic properties and reduction of toxicity

  • In Vivo Efficacy Studies:

    • Mouse models of disseminated candidiasis to test candidate inhibitors

    • Evaluation of fungal burden, survival rates, and pharmacokinetic parameters

    • Comparison with standard antifungal treatments

The table below outlines key considerations when evaluating TSC10 as a drug target:

Evaluation CriteriaKey QuestionsMethodological Approaches
EssentialityIs TSC10 essential for C. albicans viability?Gene deletion, conditional expression
SelectivityHow similar is TSC10 to human homologs?Sequence/structural comparisons, selective inhibitor testing
DruggabilityDoes TSC10 have suitable binding pockets?Structural analysis, fragment screening
Resistance potentialHow readily might resistance develop?Serial passage experiments with inhibitors
Synergy potentialDoes TSC10 inhibition enhance existing drugs?Combination studies with azoles

Can TSC10 inhibitors overcome azole resistance in Candida albicans?

The potential for TSC10 inhibitors to overcome azole resistance presents a compelling research direction:

  • Mechanistic Rationale:

    • TSC10/KSR1 modifications contribute to azole resistance through altered sphingolipid metabolism and membrane composition

    • Inhibiting TSC10 could potentially restore membrane properties conducive to azole activity

    • Targeting a different pathway than azoles may provide complementary mechanisms of action

  • Combination Therapy Approaches:

    • Testing TSC10 inhibitors in combination with fluconazole against resistant isolates

    • Evaluating potential synergistic effects through checkerboard assays and time-kill studies

    • Determining whether sub-MIC concentrations of TSC10 inhibitors can resensitize resistant strains to azoles

  • Resistance Mechanism Specificity:

    • Determining if TSC10 inhibitors are equally effective against different azole resistance mechanisms:

      • Target-based resistance (ERG11 mutations)

      • Efflux-based resistance (CDR1/CDR2 overexpression)

      • TSC10/KSR1-mediated resistance

  • Challenges and Considerations:

    • The complex interplay between sphingolipid metabolism and ergosterol biosynthesis pathways

    • Potential for cross-resistance if shared detoxification mechanisms exist

    • Need for selective inhibition to avoid host toxicity

Early research indicates that targeting sphingolipid metabolism pathways may represent a viable strategy for overcoming azole resistance, though comprehensive validation studies are needed before clinical applications can be pursued.

How do mutations in TSC10/KSR1 alter enzyme kinetics and substrate specificity?

Understanding the impact of mutations on TSC10/KSR1 enzyme kinetics requires sophisticated biochemical approaches:

  • Kinetic Parameter Determination:

    • Comparing Km, Vmax, and kcat values between wild-type and mutant TSC10 variants

    • Evaluating cofactor preferences (NADH vs. NADPH) and potential alterations in mutants

    • Assessing substrate specificity using natural and synthetic substrate analogs

  • Structural Consequences of Mutations:

    • The 711 bp LOH region identified in resistant isolates affects approximately 2/3 of the KSR1 coding sequence

    • Key mutations may affect:

      • Substrate binding pocket geometry

      • Cofactor binding sites

      • Protein stability and half-life

      • Membrane association domains

  • Catalytic Efficiency Analysis:

    • The efficiency ratio (kcat/Km) for wild-type vs. resistant variants

    • Temperature and pH optima shifts that might confer selective advantages

    • Potential allosteric regulation differences

  • Methodological Approaches:

    • Enzyme assays using purified recombinant proteins (wild-type and mutants)

    • Real-time monitoring of reaction kinetics using spectrophotometric methods

    • HPLC-ESI-MS/MS for direct quantification of substrate consumption and product formation

    • Isothermal titration calorimetry (ITC) for binding energetics

Mutations that appear to enhance resistance often represent a balance between maintaining essential catalytic function while altering aspects of regulation or membrane interaction that contribute to the resistance phenotype.

What are the systems biology approaches to understanding TSC10's role in Candida albicans pathogenicity networks?

Systems biology offers holistic approaches to understanding TSC10's role in C. albicans pathogenicity:

  • Integrated -Omics Approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Correlation of sphingolipid metabolome alterations with TSC10 variants

    • Network analysis to identify functional modules associated with TSC10

  • Genetic Interaction Mapping:

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • CRISPR interference (CRISPRi) screens to map functional relationships

    • Chemical-genetic profiling with TSC10 inhibitors or in TSC10 variant backgrounds

  • Pathway Modeling:

    • Flux balance analysis (FBA) of sphingolipid metabolism

    • Kinetic modeling of sphingolipid biosynthesis incorporating experimentally determined parameters

    • Simulation of drug effects on pathway flux and metabolite pools

  • Host-Pathogen Interaction Studies:

    • Transcriptional responses of host cells to C. albicans with different TSC10 variants

    • Impact of TSC10-dependent sphingolipid alterations on host immune recognition

    • Systems-level analysis of virulence factor expression correlated with TSC10 function

These approaches can reveal emergent properties and unexpected connections that may not be apparent from reductionist approaches focusing solely on TSC10 function in isolation.

How does environmental stress affect TSC10 expression and function in clinical Candida isolates?

Environmental stress significantly impacts TSC10 expression and function in clinical settings:

  • Transcriptional Regulation:

    • qPCR and RNA-seq analysis of TSC10/KSR1 expression under various stressors:

      • Antifungal exposure (azoles, echinocandins)

      • Oxidative stress (H2O2, neutrophil exposure)

      • Temperature stress (fever-range temperatures)

      • pH fluctuations (vaginal vs. bloodstream environments)

  • Post-Translational Modifications:

    • Phosphoproteomic analysis to identify stress-induced phosphorylation sites

    • Ubiquitination analysis to assess protein stability regulation under stress

    • Localization changes in response to environmental challenges

  • Functional Adaptations:

    • Altered sphingolipid profiles under different stress conditions

    • Changes in enzyme activity and specificity in response to stress

    • Adaptation to host microenvironments during infection progression

  • Clinical Correlations:

    • Comparison of TSC10 expression/function between colonizing and invasive isolates

    • Analysis of sequential isolates from persistent infections

    • Correlation between stress adaptation capacity and clinical outcomes

Understanding how environmental stress modulates TSC10 function provides insights into C. albicans adaptability during pathogenesis and may reveal context-dependent vulnerabilities that could be exploited therapeutically.

What emerging technologies will advance our understanding of TSC10 function and targeting?

Several cutting-edge technologies show promise for advancing TSC10 research:

  • Cryo-electron Microscopy (Cryo-EM):

    • High-resolution structural determination of membrane-associated TSC10

    • Visualization of conformational changes during catalysis

    • Structure-based drug design opportunities

  • Single-Cell Technologies:

    • Single-cell RNA-seq to capture cell-to-cell variability in TSC10 expression

    • Analysis of heterogeneous responses to antifungal treatments

    • Identification of persister cell populations with distinct TSC10 expression patterns

  • Genome Engineering Advances:

    • CRISPR-Cas9 base editing for precise mutation introduction without selection markers

    • Inducible degron systems for temporal control of TSC10 expression

    • Optogenetic control of TSC10 activity to study temporal dynamics

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize TSC10 localization and dynamics

    • Correlative light and electron microscopy (CLEM) to connect function with ultrastructure

    • Fluorescence resonance energy transfer (FRET) sensors to monitor enzyme activity in vivo

  • Computational Approaches:

    • Machine learning for prediction of resistant variants

    • Molecular dynamics simulations at extended timescales

    • Quantum mechanical/molecular mechanical (QM/MM) modeling of catalytic mechanism

These technologies will enable researchers to address persistent knowledge gaps and accelerate the development of TSC10-targeted therapeutic strategies.

How can evolutionary studies of TSC10 inform antifungal resistance prediction and prevention?

Evolutionary studies of TSC10 offer valuable insights for resistance management:

  • Predictive Models of Resistance Development:

    • Experimental evolution under controlled selective pressures

    • Identification of mutational hotspots and resistance-associated variants

    • Machine learning algorithms to predict resistance potential from genomic data

  • Population Genomics Approaches:

    • Surveillance of TSC10/KSR1 variation in clinical isolate collections

    • Tracking the spread of resistance-associated alleles in healthcare settings

    • Identification of genetic backgrounds prone to developing TSC10-mediated resistance

  • Epistatic Interactions:

    • Mapping genetic interactions between TSC10 and other resistance factors

    • Understanding how genetic background influences resistance trajectories

    • Identifying combination therapy approaches that limit resistance evolution

  • Fitness Landscape Analysis:

    • Quantifying fitness costs of resistance-conferring TSC10 mutations

    • Identifying evolutionary constraints that might be exploited therapeutically

    • Developing evolution-aware treatment strategies that discourage resistance

These evolutionary perspectives can guide the development of resistance management strategies, surveillance programs, and treatment protocols to extend the useful lifespan of current and future antifungal agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.