Recombinant Candida albicans Alpha-1,3/1,6-mannosyltransferase ALG2 (ALG2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted according to the needs of the customer.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ALG2; CAALFM_C604030WA; CaO19.1221; CaO19.8808; Alpha-1,3/1,6-mannosyltransferase ALG2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcNAc(2-PP-Dol alpha-1,6-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
ALG2
Target Protein Sequence
MSKRQENKKIAFIHPDLGIGGAERLVVDAAVGLQDFGHDIIIYTSHCDLTHCFEEVSSGQ LKVSVHGDSLPTNLFGKLHIFFAILRQFYLVCWLIFTGTIKNYDYFIVDQLSFCIPLLKM FCNSNCQVLFYCHFPDQLLVRRTSFLKKLYRVPFDAIEEYTTGSSDQIVVNSNFTKQIFH DTFKKLNHIDPQVVYPCVDTETIVDTNTSSNSEVSKFFKDSPFFLSINRFERSKNIELAI KSFARMNKLMVTNKKPRLVIAGGYDSRVAENVEYLAELSTLCDELNLINFTIRGKLIMMP PSVDVLFLPSISTQLKNSLIQQTELLLYTPPREHFGIVPLEAMLAKTPVLAINFGGPLET VVNYNGNNLDEATGYTETGDFTKWSKIIMKHYNLDESTKIKLGENGRNRVINKFSRKKLA QSLDNILN
Uniprot No.

Target Background

Function
Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Database Links
Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Candida albicans ALG2 and what is its primary function?

Candida albicans ALG2 (Alpha-1,3/1,6-mannosyltransferase) is a bifunctional enzyme that catalyzes the fourth and fifth steps of lipid-linked oligosaccharide (LLO) synthesis during asparagine (N)-linked glycosylation. This process is essential for proper protein folding and function within the endoplasmic reticulum (ER). ALG2 specifically adds both an α1,3-mannose and an α1,6-mannose onto ManGlcNAc₂-pyrophosphate-dolichol (M₁Gn₂-PDol) to form the trimannosyl core structure (Man₃GlcNAc₂-PDol) . This dual enzymatic activity makes ALG2 unusual among glycosyltransferases, as it catalyzes two distinct glycosidic linkages using the same catalytic machinery.

How does C. albicans ALG2 contribute to the N-glycosylation pathway?

The N-glycosylation pathway begins with the stepwise assembly of a common lipid-linked oligosaccharide (LLO) precursor, Glc₃Man₉GlcNAc₂-pyrophosphate-dolichol (G₃M₉Gn₂-PDol), which occurs at the ER membrane . ALG2 operates early in this pathway, forming a critical branched structure that serves as the foundation for further elaboration of the glycan. By catalyzing the formation of both α1,3- and α1,6-mannose linkages, ALG2 creates the essential branched trimannosyl core that is required for all subsequent glycan processing steps. Any defects in ALG2 function can disrupt the entire N-glycosylation process, potentially affecting multiple cellular functions dependent on properly glycosylated proteins.

What structural features enable ALG2's bifunctional activity?

Several conserved structural elements are crucial for ALG2's dual mannosyltransferase activities:

  • The C-terminal EX₇E motif (a conserved sequence containing two glutamate residues separated by seven amino acids)

  • The N-terminal cytosolic tail

  • Three G-rich loop motifs

These elements play essential roles in ALG2's function both in vitro and in vivo . While the detailed crystal structure of C. albicans ALG2 is not fully characterized in the provided literature, these conserved regions likely contribute to substrate binding, catalytic activity, and proper orientation of the enzyme at the ER membrane.

What are the mechanistic differences in the dual mannosyltransferase activities of ALG2?

ALG2 possesses the remarkable ability to catalyze the addition of mannose residues with two different linkage specificities (α1,3 and α1,6). Research has demonstrated that these additions can occur independently and in either order, though at different rates . The preference for which linkage forms first appears to be species-dependent and condition-sensitive.

  • Excess GDP-mannose donor concentration

  • Increased levels of the M₁Gn₂ substrate

Both of these factors can trigger production of the M₂Gn₂(α-1,6)-PDol intermediate instead, suggesting that ALG2 may regulate the LLO biosynthetic pathway by controlling accumulation of specific intermediates based on cellular conditions .

This mechanistic flexibility may allow for fine-tuning of the glycosylation pathway in response to various cellular stresses or metabolic states, which could be particularly relevant for a pathogen like C. albicans that must adapt to diverse host environments.

How do lipid composition and membrane properties affect ALG2 activity?

Alg2-dependent Man₃GlcNAc₂-PDol production relies on net-neutral lipids with a propensity to form bilayers . This requirement highlights the importance of the membrane environment for proper ALG2 function. The specific lipid composition likely affects multiple aspects of ALG2 activity:

  • Proper orientation and anchoring of the enzyme

  • Accessibility to membrane-embedded substrates

  • Conformational changes required for catalysis

  • Transfer efficiency of mannose residues

When designing in vitro assays or recombinant expression systems for C. albicans ALG2, researchers must carefully consider the lipid environment to ensure physiologically relevant results. Reconstitution experiments should incorporate appropriate lipid compositions that mimic the ER membrane of C. albicans.

How does ALG2 membrane topology differ between species, and what are the implications?

Significant structural divergence exists between yeast and human ALG2 proteins. Human ALG2 (hALG2) associates with the ER membrane via a single membrane-binding domain, while the well-studied yeast Alg2 interacts with the ER membrane through four hydrophobic domains . This structural difference results in hALG2 being markedly more stable in vitro.

For researchers working with C. albicans ALG2, understanding its membrane topology is crucial for:

  • Designing effective purification strategies

  • Creating functional recombinant proteins

  • Developing specific inhibitors

  • Interpreting experimental results in the context of membrane association

What quantitative methods can accurately measure ALG2 kinetics?

Liquid chromatography-mass spectrometry (LC-MS) has proven to be an effective analytical method for quantitatively studying ALG2 activity. A LC-MS-based quantitative kinetics assay was specifically developed for studying purified human ALG2 , and a similar approach was established for analyzing the mannosyltransferase activities of purified yeast Alg2 .

This methodology offers several advantages for researchers:

  • High sensitivity for detecting glycan intermediates

  • Ability to distinguish between isomeric structures with different linkages

  • Quantitative measurement of reaction rates

  • Capacity to monitor multiple reaction products simultaneously

For C. albicans ALG2 research, adapting these LC-MS methodologies would enable precise characterization of enzyme kinetics, substrate preferences, and the effects of various experimental conditions on ALG2 activity.

How can researchers optimize recombinant expression of C. albicans ALG2?

When expressing recombinant C. albicans ALG2, researchers should consider the following factors:

  • Expression system selection: Eukaryotic expression systems (particularly yeast) may provide more appropriate post-translational modifications and membrane environment than bacterial systems.

  • Membrane association: Given ALG2's membrane-associated nature, expression constructs should preserve the native membrane-binding domains or incorporate appropriate tags that don't interfere with membrane association.

  • Protein stability: Based on the comparison between human and yeast ALG2, membrane topology significantly affects protein stability . Design constructs that maintain proper folding and stability.

  • Purification strategy: Consider detergent solubilization methods that preserve enzyme activity, or membrane fraction preparations that maintain the native lipid environment.

For functional studies, researchers might need to co-express additional components of the glycosylation machinery to reconstitute full activity.

What assay conditions are optimal for measuring C. albicans ALG2 activity in vitro?

Based on established protocols for yeast and human ALG2, the following conditions should be considered when assaying C. albicans ALG2 activity:

  • Lipid composition: Include net-neutral lipids with bilayer-forming properties, as Alg2-dependent Man₃GlcNAc₂-PDol production relies on these membrane characteristics .

  • Substrate preparation: Synthesize or isolate appropriate ManGlcNAc₂-PDol substrates. The concentration of this substrate may affect which mannosylation pathway predominates .

  • GDP-Mannose concentration: Titrate GDP-mannose concentrations, as excess donor can alter the preferred order of mannose addition .

  • Detection method: Implement LC-MS methodologies for quantitative analysis of reaction products and intermediates .

  • Buffer conditions: Optimize pH, ionic strength, and divalent cation concentrations based on established mannosyltransferase assay conditions.

A standardized reaction mixture might include purified ALG2, synthetic ManGlcNAc₂-PDol substrate incorporated into appropriate lipid vesicles, GDP-mannose, and buffer components optimized for mannosyltransferase activity.

How can researchers distinguish between the α1,3- and α1,6-mannosyltransferase activities?

Distinguishing between ALG2's dual mannosyltransferase activities requires analytical techniques that can differentiate isomeric structures with different glycosidic linkages. Researchers can employ:

  • LC-MS analysis: Different retention times of the M₂Gn₂(α1,3) and M₂Gn₂(α1,6) intermediates, combined with diagnostic fragment ions in MS/MS spectra .

  • Linkage-specific glycosidases: Enzymatic treatments with α1,3- or α1,6-specific mannosidases followed by product analysis.

  • NMR spectroscopy: For detailed structural characterization of isolated reaction products.

  • Site-directed mutagenesis: Creating ALG2 variants with selective defects in either α1,3 or α1,6 mannosyltransferase activity based on conserved motifs .

The table below summarizes expected intermediate products in ALG2 reaction pathways:

Reaction StepStarting Substrateα1,3 Pathway Productα1,6 Pathway Product
First additionM₁Gn₂-PDolM₂Gn₂(α1,3)-PDolM₂Gn₂(α1,6)-PDol
Second additionM₂Gn₂(α1,3)-PDolM₃Gn₂-PDol-
Second additionM₂Gn₂(α1,6)-PDol-M₃Gn₂-PDol

What strategies can identify critical residues for ALG2's dual catalytic activities?

To identify critical residues for ALG2's dual catalytic functions, researchers can employ several complementary approaches:

  • Sequence alignment: Compare ALG2 sequences across species to identify conserved residues, particularly focusing on the C-terminal EX₇E motif, N-terminal cytosolic tail, and G-rich loop motifs known to be crucial for activity .

  • Site-directed mutagenesis: Systematically mutate conserved residues and assess the effect on each mannosyltransferase activity independently.

  • Domain swapping: Exchange domains between ALG2 and related mannosyltransferases to identify regions responsible for linkage specificity.

  • Homology modeling: Generate structural models based on related glycosyltransferases to predict catalytic and substrate-binding residues.

  • Functional complementation: Test mutant variants for their ability to rescue ALG2-deficient yeast strains, which can provide in vivo relevance to biochemical findings.

This systematic approach can help elucidate the molecular basis for ALG2's unusual dual specificity and potentially identify residues that could be targeted for selective inhibition.

How does ALG2 function relate to C. albicans pathogenicity?

While the provided search results don't directly connect ALG2 to C. albicans pathogenicity, we can make informed inferences based on the importance of N-glycosylation in fungal virulence:

  • N-glycosylated proteins form crucial components of the C. albicans cell wall and extracellular matrix, which mediate host-pathogen interactions .

  • Proper glycosylation is likely essential for the function of secreted virulence factors and adhesins, such as the Als protein family mentioned in the search results .

  • Defects in N-glycosylation could impact cellular stress responses that are important during host invasion and immune evasion.

For example, search result discusses C. albicans Als2p and Als4p adhesins, which are likely N-glycosylated proteins involved in adhesion to host cells. Deletion or downregulation of these adhesins affected germ tube formation and adhesion to various host cell types . While this doesn't directly involve ALG2, it demonstrates the importance of properly processed cell surface proteins in C. albicans virulence.

What potential exists for targeting ALG2 in antifungal development?

ALG2 represents a potential target for antifungal drug development for several reasons:

  • Essential pathway: N-glycosylation is crucial for cell viability and function in fungi.

  • Structural differences: The differences in membrane topology between human and fungal ALG2 orthologs could potentially be exploited for selective inhibition.

  • Unique bifunctional activity: The dual mannosyltransferase activities of ALG2 present unique targeting opportunities compared to single-function enzymes.

  • Cell surface effects: Inhibition of ALG2 would likely affect multiple cell surface glycoproteins simultaneously, potentially disrupting various virulence mechanisms.

Researchers developing ALG2-targeting compounds should focus on:

  • Structure-based design leveraging the unique features of fungal ALG2

  • High-throughput screening assays using recombinant C. albicans ALG2

  • Validation of hits in whole-cell assays to confirm cell permeability and target engagement

  • Assessment of selectivity against human ALG2 to minimize host toxicity

How does ALG2 function intersect with other C. albicans virulence mechanisms?

The search results provide an interesting connection between calcium signaling, membrane repair, and C. albicans pathogenicity that might indirectly relate to ALG2 function:

C. albicans hyphae secrete candidalysin, a pore-forming peptide toxin that damages host cell membranes. Host epithelial cells employ calcium-dependent repair mechanisms, including ALG-2 (a different protein from ALG2)/ALIX/ESCRT-III-dependent membrane blebbing, to maintain cellular integrity . This calcium-dependent repair pathway is crucial for epithelial cells to withstand damage from C. albicans infection.

While this ALG-2 protein (Apoptosis-Linked Gene 2, a calcium-binding protein involved in ESCRT recruitment) is distinct from the ALG2 mannosyltransferase that is our focus, this finding highlights the complex interplay between:

  • Membrane integrity and dynamics

  • Calcium signaling

  • Protein trafficking and secretion

  • Host-pathogen interactions

These interconnected processes all involve glycosylated proteins and membrane systems where ALG2 mannosyltransferase activity plays a foundational role.

What technological advances could enhance C. albicans ALG2 research?

Several emerging technologies could significantly advance research on C. albicans ALG2:

  • Cryo-EM structural analysis: Determining the membrane-associated structure of C. albicans ALG2 would provide unprecedented insights into its mechanism.

  • Glycoproteomic approaches: Advanced mass spectrometry techniques could identify specific glycoproteins affected by ALG2 dysfunction.

  • CRISPR-based genetic tools: Improved genetic manipulation techniques for C. albicans could facilitate more precise functional studies of ALG2.

  • Microfluidic devices: Systems mimicking host-pathogen interfaces could evaluate the impact of ALG2 modulation on C. albicans virulence in more physiologically relevant contexts.

  • In vitro reconstitution systems: Synthetic biology approaches could rebuild the early N-glycosylation pathway with purified components to study ALG2 in a defined system.

How might environmental conditions regulate ALG2 activity during infection?

During infection, C. albicans encounters various microenvironments that might affect ALG2 function:

  • pH fluctuations: Different host niches have varying pH, which could affect ALG2 activity and substrate preference.

  • Nutrient availability: Availability of mannose and metabolic precursors for GDP-mannose synthesis likely influences ALG2 activity.

  • Membrane stress: Host defense mechanisms or antifungal drugs targeting membranes might indirectly affect ALG2 function.

  • Hypoxia: Oxygen-limited environments in host tissues could alter ER function and potentially impact ALG2 activity.

Future research examining how these conditions affect ALG2-dependent glycosylation could provide insights into C. albicans adaptation during pathogenesis and identify potential vulnerabilities for therapeutic intervention.

What insights could comparative analysis of ALG2 across Candida species provide?

Comparative analysis of ALG2 across different Candida species could reveal:

  • Evolutionary conservation: Identification of absolutely conserved residues likely essential for catalytic activity.

  • Species-specific adaptations: Unique features that might correlate with species-specific virulence traits or host preferences.

  • Potential for selective targeting: Regions that differ from human ALG2 but are conserved across pathogenic Candida species would represent ideal drug targets.

  • Functional divergence: Different substrate preferences or regulatory mechanisms that might contribute to species-specific glycosylation patterns.

Such comparative genomic and biochemical analyses could advance both basic understanding of glycosylation evolution and applied development of pan-Candida antifungal strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.