Recombinant Candida albicans Altered inheritance of mitochondria protein 11 (AIM11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida albicans Altered Inheritance of Mitochondria Protein 11 (AIM11)

Candida albicans is a prevalent member of the human gut flora and a significant cause of hospital-acquired infections . It serves as a model organism in biology because it can grow as both yeast and filamentous cells (dimorphic fungus) . The C. albicans genome is approximately 16 Mb in its haploid form, comprising eight pairs of chromosomes (chr1A, chr2A, chr3A, chr4A, chr5A, chr6A, chr7A, and chrRA). This genome contains 6198 Open Reading Frames (ORFs), with 70% of them still uncharacterized .

Altered Inheritance of Mitochondria (AIM) proteins, including AIM11, play a crucial role in mitochondrial dynamics and inheritance in various organisms. Recombinant Candida albicans AIM11 protein is produced using genetic engineering techniques, where the AIM11 gene from C. albicans is expressed in a host organism such as E. coli, yeast, baculovirus, or mammalian cells .

Production and Characteristics of Recombinant AIM11 Protein

Recombinant Candida albicans AIM11 protein (aa 1-165) is expressed in E. coli . The Candida albicans AIM11 protein, with the alternative name Altered inheritance of mitochondria protein 11, is a recombinant protein of the Candida Albicans (strain WO-1) .

Applications in Vaccine Development

The recombinant Candida albicans AIM11 protein is useful for vaccine development . One study showed that a vaccine composed of the recombinant N terminus of Als1p (rAls1p-N) reduces fungal burden and improves survival in both immunocompetent and immunocompromised subjects .

Immunogenicity Enhancement Using Compound 11g

Research has explored enhancing the immunogenicity of Candida albicans using novel compounds. A 2-aminonicotinamide derivative named 11g was designed and synthesized, and its antifungal activity was evaluated in vitro . The influences of 11g on fungi immunogenicity were investigated, and the protective effects of 11g in vivo were studied using a murine systemic candidiasis model. Compound 11g exhibited potent antifungal activity both in vitro and in vivo. It was found that 11g caused the unmasking of the fungi β-glucan layer, leading to stronger immune responses in macrophages through Dectin-1 .

11g-treated C. albicans enhanced the phosphorylation of Syk and IκBα, as well as the degradation of IκBα in macrophages . 11g-treated C. albicans also promoted the nuclear translocation of the p65 subunit in macrophages. These activations can be significantly inhibited by laminarin, a specific inhibitor of Dectin-1 .

Impact on Cytokine Secretion in Macrophages

11g-treated C. albicans increased the secretion of TNF-α, IL-10, IL-12/23 p40, and IL-6 in macrophages after 6 hours post-infection . These activations were significantly inhibited by laminarin, suggesting that 11g-treated C. albicans elicits Dectin-1-dependent cytokine secretion in macrophages .

Quantitative Proteomics Analysis of 11g-Treated C. albicans

Quantitative proteomics analysis was conducted to understand the effect of 11g on the protein expression of C. albicans SC5314 . The expression of some GPI-anchored proteins (such as RHD3) was significantly decreased in 11g-treated C. albicans SC5314. At the same time, the expression of some proteins (such as PMI1 and PMT1) was significantly increased in 11g-treated C. albicans SC5314 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AIM11; CAWG_02421; Altered inheritance of mitochondria protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Candida albicans (strain WO-1) (Yeast)
Target Names
AIM11
Target Protein Sequence
MSDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAYRATVSRQYIPTLFQG NHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSNIKEFGWRMKSMLGGWE SEKKLSEAPMDEESSYIQDSLNDILDGKYDFENDTEEVAGELKTN
Uniprot No.

Target Background

Protein Families
AIM11 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Candida albicans AIM11 and what is known about its structure and function?

    Candida albicans AIM11 (Altered inheritance of mitochondria protein 11) is a protein found in the pathogenic fungus C. albicans. The recombinant form typically studied consists of amino acids 1-165 from the WO-1 strain . As its name suggests, AIM11 likely plays a role in mitochondrial inheritance or function, though specific mechanisms remain to be fully characterized. C. albicans is a common member of human gut flora and a significant cause of hospital-acquired infections, growing as both yeast and filamentous cells (dimorphic fungus) .

  • What expression systems are suitable for producing recombinant C. albicans AIM11?

    According to available research, recombinant C. albicans AIM11 protein can be produced in several expression systems including E. coli, Yeast, Baculovirus, or Mammalian Cell systems . The choice depends on research requirements:

    Expression SystemAdvantagesLimitationsBest For
    E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsStructural studies, antibody production
    YeastEukaryotic system, some post-translational modificationsLower yield than E. coliFunctional assays requiring some modifications
    BaculovirusComplex eukaryotic modifications, high yieldMore complex, time-consumingStudies requiring authentic eukaryotic modifications
    Mammalian CellMost authentic post-translational modificationsLower yield, highest costInteraction studies with host proteins
  • What is the genomic context of AIM11 in C. albicans?

    C. albicans has a genome of approximately 16 Mb (haploid size) organized into 8 sets of chromosome pairs (chr1A through chr7A, and chrRA) . The genome contains 6198 Open Reading Frames (ORFs), with 70% still uncharacterized . This genomic complexity presents both challenges and opportunities for researchers studying proteins like AIM11. Understanding the genomic context may reveal regulatory elements and potential functional relationships with other genes.

Advanced Research Questions

  • How should researchers design experiments to investigate AIM11's role in C. albicans virulence?

    When investigating AIM11's potential role in virulence, a methodical approach should include:

    • Gene knockout studies using CRISPR-Cas9 or homologous recombination to generate AIM11-deficient strains

    • Complementation studies to confirm phenotypes are specifically due to AIM11 loss

    • Virulence assessment in various infection models (cell culture, Galleria mellonella, murine models)

    • Analysis of virulence-associated phenotypes (hyphal formation, biofilm development, adhesion)

    • Mitochondrial function assessment (membrane potential, respiration, ROS production)

    These approaches are particularly relevant as mitochondrial function has been demonstrated to modulate virulence and antifungal resistance in Candida species .

  • What techniques are most effective for characterizing protein-protein interactions involving AIM11?

    To effectively characterize AIM11 interactions, researchers should consider:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Yeast two-hybrid screening

    • Proximity-dependent biotin identification (BioID)

    • Co-immunoprecipitation with tagged AIM11

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

    • Split-GFP complementation assays

    When applying these techniques to mitochondrial proteins like AIM11, proper mitochondrial isolation protocols are critical to maintain protein complex integrity.

  • How can researchers distinguish between direct and indirect effects of AIM11 on mitochondrial function?

    Distinguishing direct from indirect effects requires rigorous experimental design:

    • Time-course studies to establish the sequence of events following AIM11 manipulation

    • Subcellular localization studies using fluorescent protein fusions or immunogold electron microscopy

    • In vitro reconstitution experiments with purified components

    • Site-directed mutagenesis to identify critical functional domains

    • Conditional expression systems to control AIM11 levels temporally

    • Genetic suppressor screens to identify functional pathways

    For mitochondrial proteins, measurements should include membrane potential, respiratory chain activity, mitochondrial morphology, and mtDNA maintenance.

  • What approaches should be used to investigate potential connections between AIM11 and antifungal resistance?

    To investigate AIM11's potential role in antifungal resistance, researchers should:

    • Compare minimum inhibitory concentrations (MICs) of various antifungals in wild-type vs. AIM11-deficient strains

    • Assess changes in AIM11 expression following antifungal exposure

    • Examine mitochondrial function parameters in resistant vs. susceptible strains

    • Investigate metabolic adaptations that might be influenced by AIM11

    • Study potential interactions between AIM11 and known resistance mechanisms

    • Perform transcriptomic and proteomic analyses to identify affected pathways

    This is particularly relevant as mitochondrial function has been linked to antifungal resistance in Candida species .

  • How might strain-specific variations in AIM11 affect experimental outcomes and interpretation?

    Strain variations can significantly impact experimental results:

    ConsiderationMethodological ApproachPotential Impact
    Sequence variationsComparative genomics across strainsFunctional differences in protein activity
    Expression levelsqRT-PCR and western blottingVariation in phenotypic manifestations
    Post-translational modificationsMass spectrometry analysisAltered regulatory mechanisms
    Protein-protein interactionsInteractome studies in different strainsStrain-specific functional networks
    Subcellular localizationImmunofluorescence microscopyDifferent compartmentalization

    The specific focus on the WO-1 strain for recombinant AIM11 production highlights the importance of strain considerations in experimental design.

  • What methodological approaches can resolve contradictory data about AIM11 function?

    When facing contradictory results:

    • Systematically evaluate experimental conditions that may contribute to differences

    • Use multiple complementary techniques to address the same question

    • Employ genetic approaches (knockouts, complementation) combined with biochemical validation

    • Consider strain backgrounds, growth conditions, and model systems as sources of variation

    • Utilize advanced imaging techniques to directly visualize AIM11 behavior in situ

    • Develop in vitro assays to test specific biochemical activities in controlled environments

    Standardizing protocols across research groups can help resolve apparent contradictions in the literature.

  • How should researchers interpret AIM11 studies in the broader context of mitochondrial proteins in fungal pathogens?

    When interpreting AIM11 studies, researchers should:

    • Compare findings with known mitochondrial protein functions in other fungal species

    • Consider evolutionary conservation and divergence of mitochondrial proteins

    • Examine parallels with mitochondrial inheritance proteins in model organisms

    • Evaluate effects on mitochondrial genome maintenance, as mitochondrial genomes in Candida species contain core protein-coding genes that influence virulence

    • Integrate findings into broader models of mitochondrial contribution to fungal pathogenesis

    • Consider potential translational applications for antifungal development

    This comparative approach can place AIM11 research within the larger context of fungal mitochondrial biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.