Recombinant Candida albicans Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

What is AIM31 protein and what is its significance in Candida albicans biology?

AIM31 (Altered Inheritance of Mitochondria protein 31) in Candida albicans is a 155-amino acid mitochondrial protein also known as Respiratory supercomplex factor 1 (RCF1) . The protein is encoded by the RCF1 gene (synonyms: AIM31, CAWG_04752) and plays a role in mitochondrial function .

The significance of AIM31 stems from its location in the mitochondria, suggesting involvement in energy metabolism and potentially in the organism's ability to adapt to different host environments. While direct research on AIM31 is limited, its study is important for understanding C. albicans biology as mitochondrial function is crucial for fungal virulence and stress adaptation. Research methods should focus on gene deletion studies, protein localization experiments, and functional assays measuring respiratory capacity under different environmental conditions.

What is the amino acid sequence and structural features of Candida albicans AIM31?

The full-length Candida albicans AIM31 protein consists of 155 amino acids with the following sequence:

MSVRLPSSMSYGEEEEPDVLQKMWDKSKQQPFVPLGSLLTAGAVLLAARSMKRGEKLKTQRYFRYRIGFQLATLVALVGGGFYYGTETSQHKQTREDKLREKAKQREKLWIEELERRDAIIQARKQRLEESKKELRELAKQGFIEEKESNDKKED

Structural analysis suggests AIM31 contains transmembrane domains consistent with its mitochondrial membrane localization. The protein appears to have hydrophobic regions (particularly the "LLTAGAVLLAARSMKR" segment) which likely anchor it in the mitochondrial membrane . Researchers investigating AIM31 structure should employ techniques such as circular dichroism spectroscopy, X-ray crystallography, or NMR spectroscopy to further elucidate its three-dimensional conformation, which would provide insights into its functional mechanisms within mitochondrial membranes.

How does AIM31 compare to similar proteins in other fungal species?

Comparative analysis reveals AIM31 has homologs in other fungal species, including Neosartorya fumigata (Aspergillus fumigatus) . While sequence homology exists between these proteins, functional studies are needed to determine conservation of biological roles across species.

To investigate functional conservation, researchers should employ complementation studies where the AIM31 gene from various fungal species is expressed in C. albicans AIM31 deletion mutants to assess functional rescue. Additionally, phylogenetic analysis can reveal evolutionary relationships and potentially identify functionally important conserved domains. Protein interaction studies comparing binding partners across species would further illuminate functional conservation or divergence of AIM31 homologs in the fungal kingdom.

What are the optimal expression systems for recombinant AIM31 production?

How might AIM31 contribute to mitochondrial function and Candida albicans pathogenicity?

AIM31's role in mitochondrial function likely impacts C. albicans pathogenicity through several potential mechanisms:

• Energy metabolism regulation during host adaptation

• Stress response during immune attack

• Morphological switching between yeast and hyphal forms

• Biofilm formation capacity

To investigate these potential roles, researchers should design experiments comparing wild-type and AIM31 deletion strains in various conditions mimicking host environments. Key methodological approaches include:

• Measuring oxygen consumption rates and ATP production in different carbon sources

• Assessing mitochondrial membrane potential using fluorescent probes

• Testing susceptibility to oxidative stress and antifungal drugs

• Examining hyphal formation under inducing conditions

• Quantifying virulence in infection models

The significance of mitochondrial function in pathogenicity is underscored by the importance of metabolic flexibility during infection. C. albicans must adapt to diverse nutrient conditions within the host, and mitochondrial proteins like AIM31 may be crucial for this adaptation .

What experimental approaches are recommended for studying AIM31 protein interactions?

To elucidate AIM31's interactome and functional networks, researchers should employ multiple complementary approaches:

• Co-immunoprecipitation (Co-IP): Using antibodies against tagged AIM31 to pull down interaction partners, followed by mass spectrometry identification.

• Proximity-based labeling: Techniques such as BioID or APEX where AIM31 is fused to a biotin ligase that biotinylates proximal proteins, enabling their identification.

• Yeast two-hybrid screening: Although potentially prone to false positives, this system can identify direct protein-protein interactions.

• Crosslinking mass spectrometry: Chemical crosslinking of AIM31 to nearby proteins in intact mitochondria followed by mass spectrometry analysis.

• Split-reporter assays: Fusing fragments of fluorescent proteins or enzymes to AIM31 and potential interaction partners to visualize interactions in vivo.

For validating identified interactions, researchers should use multiple orthogonal methods and integrate results with functional assays measuring mitochondrial parameters such as respiratory capacity, membrane potential, and morphology. This multi-faceted approach will provide a comprehensive understanding of AIM31's protein-protein interaction network and functional significance.

What are the recommended protocols for purifying recombinant AIM31 protein?

The purification of recombinant AIM31 protein requires careful optimization to maintain protein stability and functionality. Based on available protocols, the following methodology is recommended:

• Expression System Selection: E. coli has been successfully used for AIM31 expression with an N-terminal His tag . The protein is typically expressed as a full-length construct (amino acids 1-155).

• Cell Lysis: Cells should be lysed in a Tris/PBS-based buffer (pH 8.0) containing protease inhibitors. Sonication or high-pressure homogenization is recommended for efficient lysis without denaturing the protein.

• Affinity Purification:

  • Use Ni-NTA or other metal affinity resin for His-tagged AIM31

  • Equilibrate column with lysis buffer

  • Apply clarified lysate

  • Wash with increasing imidazole concentrations (10-40 mM)

  • Elute with 250-300 mM imidazole

• Secondary Purification:

  • Size exclusion chromatography is recommended to achieve >90% purity

  • Ion exchange chromatography may be used as an alternative or additional step

• Storage and Stability:

  • The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Aliquot and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • For long-term storage, add glycerol to a final concentration of 50%

• Reconstitution:

  • Prior to use, centrifuge vials briefly to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

When working with AIM31, researchers should verify protein quality by SDS-PAGE and consider functional assays to ensure the recombinant protein retains its native properties.

How can researchers effectively design experiments to study AIM31's role in mitochondrial function?

To comprehensively investigate AIM31's role in mitochondrial function, researchers should implement a multi-layered experimental approach:

• Genetic Manipulation Strategies:

  • Generate precise deletion mutants using CRISPR-Cas9 or homologous recombination

  • Create conditional expression strains using tetracycline-regulatable promoters

  • Develop fluorescently tagged AIM31 strains for localization studies

  • Implement complementation with mutated versions to identify critical residues

• Mitochondrial Function Assays:

  • Measure oxygen consumption rates using respirometry

  • Assess mitochondrial membrane potential using JC-1 or TMRM dyes

  • Quantify ATP production under different carbon sources

  • Analyze respiratory complex assembly using blue native PAGE

  • Evaluate mitochondrial network morphology using confocal microscopy

• Stress Response Experiments:

  • Test sensitivity to oxidative stress (H₂O₂, menadione)

  • Evaluate growth under hypoxic conditions

  • Measure response to electron transport chain inhibitors

  • Assess adaptation to different carbon sources

• Integration with Pathogenicity Models:

  • Compare wild-type and mutant strains in macrophage interaction assays

  • Assess virulence in validated invertebrate or vertebrate infection models

  • Measure biofilm formation capacity

When interpreting results, researchers should correlate mitochondrial phenotypes with virulence traits to establish causative relationships. Additionally, complementary biochemical approaches such as protein-protein interaction studies and lipidomic analysis would provide deeper mechanistic insights into AIM31 function.

What analytical techniques are most effective for investigating post-translational modifications of AIM31?

Investigating post-translational modifications (PTMs) of AIM31 requires sophisticated analytical approaches. The most effective techniques include:

• Mass Spectrometry-Based Methods:

  • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) with enrichment strategies for specific PTMs

  • Multiple reaction monitoring (MRM) for targeted quantification of modified peptides

  • Electron transfer dissociation (ETD) or electron capture dissociation (ECD) for labile modifications

  • Top-down proteomics to analyze intact protein with modifications

• Site-Specific Mutagenesis:

  • Mutate potential modification sites (serine, threonine, tyrosine for phosphorylation; lysine for ubiquitination/acetylation)

  • Create phosphomimetic mutations (S/T to D/E) or non-phosphorylatable mutations (S/T to A)

  • Assess functional consequences of mutations

• PTM-Specific Antibodies:

  • Western blotting with antibodies against common PTMs (phospho, acetyl, ubiquitin)

  • Immunoprecipitation to enrich modified forms

• Biochemical Approaches:

  • Phosphatase treatment to remove phosphorylation

  • Deacetylase treatment to remove acetylation

  • Analysis of mobility shifts by SDS-PAGE or Phos-tag gels

Researchers should combine these techniques for comprehensive PTM characterization and correlate modifications with specific growth conditions or stress responses. This approach will reveal how post-translational regulation of AIM31 contributes to C. albicans adaptation and pathogenicity under varying environmental conditions.

How should researchers interpret contradictory findings regarding AIM31 function across different experimental systems?

When encountering contradictory findings regarding AIM31 function, researchers should implement a systematic analytical approach:

• Experimental Context Analysis:

  • Compare precisely what was measured in each study (direct vs. indirect measurements)

  • Evaluate strain backgrounds (clinical isolates vs. laboratory strains)

  • Assess environmental conditions (media composition, temperature, pH, oxygen levels)

  • Examine time points chosen for analysis (acute vs. chronic responses)

• Methodological Evaluation:

  • Scrutinize experimental techniques (sensitivity, specificity, limitations)

  • Consider the resolution of techniques used (single-cell vs. population measurements)

  • Analyze statistical approaches and sample sizes

  • Evaluate whether appropriate controls were included

• Integration Framework:

  • Develop models that can accommodate seemingly contradictory results

  • Consider that AIM31 may have context-dependent functions

  • Explore potential compensatory mechanisms in different genetic backgrounds

  • Investigate whether protein abundance affects functional outcomes

• Validation Strategies:

  • Design experiments specifically to resolve contradictions

  • Implement orthogonal techniques to measure the same parameter

  • Conduct side-by-side comparisons under identical conditions

  • Perform epistasis analysis with other mitochondrial factors

Ultimately, apparent contradictions often reflect biological complexity rather than experimental error. AIM31's function may vary based on cellular context, genetic background, or environmental conditions. Researchers should integrate findings into a comprehensive model that accounts for this complexity, potentially revealing how AIM31 contributes to C. albicans adaptability across diverse host microenvironments.

What are the experimental considerations when investigating AIM31's potential role in antifungal resistance?

Investigating AIM31's potential role in antifungal resistance requires careful experimental design considering multiple factors:

• Selection of Antifungal Agents:

  • Test multiple classes (azoles, echinocandins, polyenes)

  • Include both fungistatic and fungicidal compounds

  • Consider clinically relevant concentrations

• Resistance Development Protocols:

  • Compare acute tolerance vs. acquired resistance

  • Implement gradual exposure protocols to mimic clinical resistance development

  • Analyze stability of resistance phenotypes

• Genetic Manipulation Approaches:

  • Create precise AIM31 deletion mutants using CRISPR-Cas9

  • Develop strains with controlled AIM31 expression levels

  • Generate point mutations in functional domains

  • Perform complementation studies to confirm phenotypes

• Phenotypic Characterization:

  • Determine minimum inhibitory concentrations (MICs) using standardized methods

  • Perform time-kill assays under different metabolic conditions

  • Assess biofilm formation and antifungal penetration

  • Monitor mitochondrial function parameters (membrane potential, ROS production)

  • Evaluate morphological transitions under antifungal pressure

• Analytical Methods:

  • Measure antifungal uptake and efflux rates

  • Quantify expression of known resistance genes

  • Perform metabolomic analysis to identify adaptive changes

  • Assess mitochondrial DNA stability and copy number

• Relevance to Clinical Isolates:

  • Validate findings in diverse clinical isolates with different resistance profiles

  • Compare results between laboratory strains and recent clinical isolates

  • Correlate with treatment outcomes when possible

By implementing this comprehensive approach, researchers can determine whether AIM31 directly contributes to antifungal resistance or affects resistance mechanisms indirectly through its impact on mitochondrial function, energy metabolism, or stress responses. This knowledge could potentially lead to novel therapeutic strategies targeting mitochondrial functions in combination with conventional antifungals.

How might AIM31 research contribute to potential therapeutic strategies against Candida infections?

AIM31 research could contribute to novel therapeutic strategies through several promising avenues:

• Target Identification and Validation:

  • If AIM31 proves essential for virulence or stress adaptation, it could represent a novel drug target

  • Structural studies could enable rational design of inhibitors specific to fungal AIM31

  • Protein-protein interaction studies may reveal additional targetable nodes in mitochondrial networks

• Vaccine Development Considerations:

  • Assess AIM31 as a potential vaccine antigen, similar to approaches with other Candida proteins like Als1p

  • Evaluate immunogenicity and protective efficacy in animal models

  • Determine if anti-AIM31 antibodies affect fungal fitness or virulence

• Combination Therapy Strategies:

  • Investigate whether AIM31 modulation sensitizes C. albicans to existing antifungals

  • Test synergy between mitochondrial inhibitors and conventional antifungals

  • Develop dual-targeting approaches affecting both AIM31 and other cellular processes

• Diagnostic Applications:

  • Explore AIM31 as a biomarker for specific Candida strains or phenotypes

  • Develop detection methods for AIM31 expression levels correlating with virulence

• Host-Pathogen Interaction Insights:

  • Understand how AIM31-dependent mitochondrial functions influence host immune responses

  • Investigate potential for immunomodulatory approaches targeting pathways affected by AIM31

Researchers should particularly focus on comparative studies between human and fungal mitochondrial systems to identify fungal-specific vulnerabilities that could be exploited therapeutically. The success of the recombinant Als1p-N vaccine approach , which showed efficacy even in immunocompromised models, suggests that targeted approaches against specific Candida components can yield promising therapeutic candidates. AIM31's mitochondrial localization provides an advantage as mitochondrial functions are increasingly recognized as critical for fungal pathogenicity and represent an underexploited therapeutic target space.

What integrative approaches can reveal comprehensive insights into AIM31's role in Candida albicans biology?

To gain comprehensive insights into AIM31's biological role, researchers should implement integrative multi-omics approaches:

• Systems Biology Framework:

  • Combine transcriptomics, proteomics, and metabolomics data from AIM31 mutants

  • Develop computational models of mitochondrial function incorporating AIM31

  • Map AIM31-dependent networks across different environmental conditions

  • Integrate with existing C. albicans interactome data

• Temporal and Spatial Resolution:

  • Implement time-course experiments to capture dynamic responses

  • Develop subcellular fraction proteomics focusing on mitochondrial compartments

  • Utilize single-cell approaches to identify population heterogeneity

  • Track AIM31 localization during different growth phases and stress conditions

• Host-Pathogen Interface Analysis:

  • Examine AIM31-dependent responses during macrophage interaction

  • Profile AIM31 mutants during in vivo infection using tissue-specific approaches

  • Compare AIM31 function in commensal versus pathogenic states

• Evolutionary Context:

  • Conduct comparative analyses across Candida species with different virulence profiles

  • Examine AIM31 conservation and divergence in relation to pathogenicity

  • Investigate potential horizontal gene transfer events affecting AIM31

• Connection to Genetic Diversity:

  • Assess AIM31 sequence and expression variation across clinical isolates

  • Correlate with the known parasexual reproduction mechanisms in C. albicans

  • Investigate whether AIM31 contributes to genetic adaptation during infection

By integrating these diverse approaches, researchers can develop a comprehensive understanding of AIM31's role in C. albicans biology, potentially revealing unexpected connections to virulence, stress adaptation, and evolution of this important human fungal pathogen. Such knowledge would not only advance basic science but could ultimately inform novel therapeutic strategies targeting this persistent pathogen.