Recombinant Candida albicans Assembly factor CBP4 (CBP4)

Shipped with Ice Packs
In Stock

Description

Role of CBP4 in Mitochondrial Function

CBP4 is involved in the assembly of mitochondrial respiratory complexes, which are crucial for energy production in C. albicans. Mitochondrial function is essential for the survival and virulence of C. albicans, as it affects various cellular processes, including metabolism and stress response.

ProteinRole in Mitochondrial FunctionImpact on C. albicans
CBP4Assembly factor for mitochondrial complexesEssential for energy production and cellular stress response
COX11Uncharacterized protein involved in cytochrome c oxidase assemblyContributes to mitochondrial respiratory chain assembly
COX15Involved in cytochrome c oxidase assemblyImportant for mitochondrial function and energy metabolism

Research Findings on CBP4

While specific studies on recombinant CBP4 are scarce, research on mitochondrial assembly factors in C. albicans suggests that these proteins play critical roles in maintaining mitochondrial integrity and function. For instance, studies on antifungal agents like SM21 have shown that mitochondrial damage can lead to resistance mechanisms in C. albicans, highlighting the importance of mitochondrial function in fungal survival .

Potential Applications of CBP4 Research

Understanding the role of CBP4 and other mitochondrial assembly factors could lead to the development of novel antifungal strategies. Targeting mitochondrial function could provide a new avenue for combating C. albicans infections, especially in cases where traditional antifungals are ineffective due to resistance.

References

  1. Frontiers in Cellular and Infection Microbiology: Recent Advances and Opportunities in the Study of Candida albicans.

  2. PMC: Genomic Profiling of the Response of Candida albicans to Antifungal Agents.

  3. PMC: Antifungal Agent 4-AN Changes the Genome-Wide Expression Profile, Downregulates Virulence-Associated Genes and Induces Necrosis in Candida albicans Cells.

  4. PMC: Use of Haploid Model of Candida albicans to Uncover Mechanism of Antifungal Drug Resistance.

  5. PLOS Genetics: A Human-Curated Annotation of the Candida albicans Genome.

  6. PMC: Enhancing Antifungal Drug Discovery Through Co-Culture with Antarctic Streptomyces albidoflavus Strain CBMAI 1855.

  7. PLOS Pathogens: Genome-Wide Fitness Test and Mechanism-of-Action Studies of Candida albicans.

  8. Candida Genome Database: A resource for genomic sequence data and gene and protein information for Candida albicans and related species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CBP4; CAALFM_C108470WA; CaO19.392; CaO19.8022; Assembly factor CBP4; Cytochrome b mRNA-processing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
CBP4
Target Protein Sequence
MSAVKPLWYRWARVYFAGGCLVGTGVLFWYTIRPTDEQLIARFSPEVKADYERNKELRQQ EQKRLIEIVKETSSSSDPIWKAGPIGSPFEKEQRNLSMELVDAELFHKTKHEEQQKQEID RANEESKEAERLMQQNKKPWWKFF
Uniprot No.

Target Background

Function
Essential for the assembly of ubiquinol-cytochrome c reductase. It directly influences the correct incorporation of the Rieske protein, core 4, core 5, and apocytochrome b.
Database Links
Protein Families
CBP4 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.