Recombinant Candida albicans ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Candida albicans ATP Synthase Subunit a (ATP6)

The ATP synthase subunit a (ATP6), encoded by mitochondrial DNA in Candida albicans, is a critical component of the F₀ sector of the mitochondrial ATP synthase (Complex V). This subunit forms part of the proton channel responsible for transmembrane proton transport, which drives ATP synthesis in oxidative phosphorylation . Recombinant ATP6 refers to the engineered production of this protein in heterologous systems (e.g., Saccharomyces cerevisiae, Escherichia coli, or mammalian cells) to study its structure, function, and role in pathogenicity.

Key Features of ATP6 in C. albicans:

PropertyDescription
Genetic OriginEncoded by mitochondrial DNA (ATP6) .
Structural RoleForms the proton channel in the F₀ sector alongside subunits ATP8 and ATP9 .
Functional ImportanceEssential for ATP synthesis and energy production in oxidative phosphorylation .

Recombinant Production Challenges

Producing recombinant ATP6 poses technical hurdles due to its hydrophobic nature and requirement for proper membrane integration. Lessons from S. cerevisiae studies highlight:

ChallengeApproach
Protein SolubilityUse of membrane-mimetic systems (e.g., lipid nanodiscs or detergent micelles) .
Folding AccuracyCo-expression with chaperones (e.g., ATP11p, ATP12p in S. cerevisiae) .
Functional ValidationAssays for proton transport and ATP synthase activity in reconstituted systems .

Role in Pathogenicity and Disease Models

While C. albicans ATP6 has not been directly studied in pathogenicity models, insights from human MT-ATP6 variants provide a framework:

  • Mutational Impact: Pathogenic MT-ATP6 mutations (e.g., p.G167S, p.H168R) disrupt proton channel function, impairing ATP synthesis .

  • Heteroplasmy Effects: In humans, heteroplasmic MT-ATP6 mutations correlate with neurodegenerative disorders, suggesting analogous mechanisms in C. albicans may influence virulence .

Research Gaps and Future Directions

Research AreaPotential Focus
Structural CharacterizationCryo-EM studies of recombinant ATP6 in lipid bilayers.
Regulatory MechanismsInvestigating F₁-dependent translational control in C. albicans .
Therapeutic TargetsScreening antifungal agents targeting ATP6-proton channel dynamics.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; CM_00160C; CaalfMp06; ATP synthase subunit a; ATP synthase subunit 6; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
4-246
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
ATP6
Target Protein Sequence
SPLDQFEIKPLLMVNNILTLALTNYTLYLIIVVSIIFGYTSIISNGRLGSTRWGVAIIAI YDTILNLVYSQIGKAGGHFFPLIFTIFNLIFAANLISMIPYSFAISAQLVAIVSFSLALW IGNVILGLYLHGWGFFALFVPSGTPLPLVPILVLIEALSYSSRAISLGLRLGANILSGHL LMLILGSLIVNLMSSSILGFIGGIVPIVAVIAITILEVGIAIIQAYVFSILLSGYIKDSV SLH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. ATP synthase subunit a is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (ATP6) in Candida albicans?

ATP synthase subunit a (ATP6) is a critical component of the mitochondrial F1Fo-ATP synthase complex in Candida albicans. The mature ATP6 protein contains 243 amino acid residues with a predicted molecular mass of approximately 26.5 kDa, based on studies of similar proteins in related yeast species . ATP6 is encoded by the mitochondrial genome and forms part of the membrane-embedded Fo portion of the ATP synthase complex that facilitates proton movement across the inner mitochondrial membrane, which is essential for ATP synthesis during oxidative phosphorylation.

Unlike the model yeast Saccharomyces cerevisiae, C. albicans possesses a facultative anaerobic metabolism with mitochondrially encoded respiratory Complex I (CI) subunits and cannot tolerate loss of mitochondrial DNA . ATP6, along with ATP8 and ATP9, constitutes the mitochondrially encoded subunits of Complex V (ATP synthase) . The expression of the bicistronic ATP8-ATP6 mRNA in C. albicans is controlled by specific proteins such as CaAep3p, which performs an evolutionarily conserved function similar to its ortholog in S. cerevisiae .

How can the ATP6 gene be isolated and cloned from Candida albicans?

The isolation and cloning of the ATP6 gene from C. albicans mitochondrial DNA requires a methodical approach:

  • Mitochondrial DNA extraction: Isolate intact mitochondria from C. albicans cells grown to log phase in appropriate media such as YPGal, followed by standard mitochondrial DNA purification procedures .

  • Library construction: Create a mitochondrial DNA library using appropriate vectors. For example, in related yeast studies, the structural mitochondrial ATP6 gene was isolated from a mitochondrial DNA library using oligonucleotide probe procedures .

  • Screening and identification: The gene can be identified using:

    • Oligonucleotide probes designed based on conserved regions of ATP6 from related species

    • PCR amplification with primers designed from flanking conserved sequences

    • Next-generation sequencing of the mitochondrial genome followed by bioinformatic analysis

  • Cloning: The identified ATP6 gene can be cloned into appropriate vectors. In similar studies with yeast mitochondrial genes, the gene and surrounding regions were cloned into phage vectors such as M13tg130 and M13tg131 .

  • Verification: Sequence the cloned gene to confirm the open reading frame. The complete mtDNA sequence of C. albicans strain SC5314 is available in GenBank (AF285261.1) and can be used as a reference for verification .

What experimental approaches are used to study ATP6 function in Candida albicans?

Several experimental approaches have been employed to study ATP6 function in C. albicans:

  • Gene deletion studies: Creating null mutants (e.g., atp6Δ/Δ) and gene-reconstituted strains to assess the phenotypic effects of ATP6 loss . These genetic manipulation techniques include:

    • Biolistic transformation using DNA fragments with homologous arms to the ATP6 gene

    • Use of selectable markers such as recoded ARG8 for identification of transformants

  • Phenotypic characterization:

    • Growth rate analysis in different carbon sources (fermentable vs. non-fermentable)

    • Cell viability assessments

    • Measurement of cellular ATP content

    • Assessment of mitochondrial membrane potential (ΔΨm)

    • Quantification of reactive oxygen species (ROS) production

  • Transcriptomic analysis: RNA sequencing of mitochondrial transcripts to analyze expression patterns of ATP6 and other mitochondrial genes under various conditions .

  • Protein analysis:

    • Extraction of ATP6 subunit using organic solvent mixtures

    • Purification by reverse-phase HPLC

    • Determination of N-terminal sequences to identify post-translational modifications

  • Virulence studies: In vivo assessment using animal models (e.g., murine model of disseminated candidiasis) to evaluate the role of ATP6 in pathogenicity .

How does ATP6 deletion affect mitochondrial function and virulence in Candida albicans?

Deletion of the ATP6 gene in C. albicans results in profound effects on mitochondrial function and virulence:

  • Impact on energy metabolism:

    • ATP6 deletion mutants (atp6Δ/Δ) show significantly reduced growth rates in synthetic medium compared to complex medium

    • Cellular ATP content is drastically depleted, particularly when grown on non-fermentable carbon sources

    • The mutants exhibit immediate and sharp reduction in cell viability on non-fermentable carbon sources, highlighting ATP6's critical role in respiratory metabolism

  • Mitochondrial membrane potential and ROS production:

    • ATP6 deletion leads to decreased mitochondrial membrane potential (ΔΨm) regardless of media composition

    • ROS levels show a complex temporal pattern in ATP6 mutants:

      • Initially higher ROS production (207.2% in heteroplasmic ATP6/atp6 strain and 378.6% in homoplasmic atp6 strain compared to wild-type) after 8 hours of aerobic growth

      • ROS levels decrease with prolonged aerobic culturing, reaching only 22.3% of wild-type levels after 24 hours

  • Virulence attenuation:

    • ATP6 deletion mutants display avirulence in murine models of disseminated candidiasis

    • Lower fungal loads are observed in mouse organs infected with atp6Δ/Δ mutants

  • Metabolic adaptations:

    • Transcriptional changes activate alternative ATP-generating pathways to temporarily improve cell viability during initial growth phases

    • The inability to utilize non-fermentable carbon sources appears to be the primary mechanism underlying the avirulence phenotype, highlighting the importance of metabolic flexibility during infection

StrainROS Production (% of wild-type)
8h aerobic20h aerobic24h aerobic
ATP6 (wild-type)100%100%100%
ATP6/atp6 (heteroplasmic)207.2%~100%Not specified
atp6 (homoplasmic deletion)378.6%≤100%22.3%

This data table demonstrates the dynamic changes in ROS production in ATP6 mutants over time under aerobic conditions .

What challenges exist in generating stable ATP6 mutants in Candida species, and how can they be overcome?

Generating stable ATP6 mutants in Candida species presents several significant challenges:

  • Mitochondrial DNA heteroplasmy:

    • In C. glabrata, ATP6 deletion through biolistic transformation resulted in heteroplasmic strains containing both original and transformed mtDNA

    • The original mtDNA was not lost spontaneously, even under selective pressure

    • Transformed mtDNA was selectively lost under aerobic conditions

  • Environmental selection pressures:

    • Aerobic conditions facilitate the loss of original mtDNA in heteroplasmic strains

    • Anaerobic conditions favor the loss of transformed mtDNA

    • This dynamic selective pressure complicates the maintenance of stable mutants

  • ROS production:

    • Increased ROS production in mitochondria lacking ATP6 plays an important role in determining heteroplasmy dynamics

    • ROS levels fluctuate over time, affecting the stability of the mutant genotype

Methodological solutions:

  • Controlled growth conditions:

    • Strategic alternation between aerobic and anaerobic growth conditions

    • Careful monitoring of cell division rates and selection pressures

  • Selection strategies:

    • Use of appropriate genetic markers (e.g., recoded ARG8 for arginine prototrophy)

    • Maintenance of continuous selective pressure

    • Regular verification of heteroplasmy status via PCR, qPCR, and Southern blotting

  • Generation of homoplasmic strains:

    • Extended growth under controlled conditions to favor either loss of original mtDNA or transformed mtDNA

    • Use of PCR-based screening to identify colonies with homoplasmic mtDNA profiles

    • Detailed investigation of ROS production to understand and manipulate heteroplasmy dynamics

  • Alternative genetic approaches:

    • Targeting nuclear genes that affect ATP6 expression rather than direct mtDNA manipulation

    • Using PPR proteins that regulate the expression of mitochondrially encoded ATP synthase subunits

How does recombinant expression of ATP6 differ between Candida albicans and Saccharomyces cerevisiae systems?

The expression of recombinant ATP6 presents distinct challenges and considerations in C. albicans compared to S. cerevisiae:

  • Genetic code variations:

    • Comparative analysis between protein and DNA sequences shows that the CUN codon family codes for leucine in C. parapsilosis mitochondria, which may have implications for recombinant expression systems

    • These codon usage differences must be accounted for when designing expression constructs

  • Post-translational processing:

    • ATP6 undergoes post-translational cleavage in both C. albicans and S. cerevisiae, but with potential differences in processing mechanisms

    • The mature C. parapsilosis ATP6 contains 243 amino acid residues, with evidence of post-translational cleavage similar to S. cerevisiae

  • Sequence homology:

    • The ATP6 subunit shows approximately 52% similarity between C. parapsilosis and S. cerevisiae

    • These differences may affect protein folding, stability, and functionality in heterologous expression systems

  • Complex assembly requirements:

    • In C. albicans, ATP6 exists as part of a bicistronic mRNA (ATP8-ATP6) controlled by specific proteins like CaAep3p

    • This coordinated expression may be critical for proper complex assembly and function

  • Respiratory requirements:

    • Unlike S. cerevisiae, C. albicans possesses mitochondrially encoded respiratory Complex I subunits and cannot tolerate loss of mtDNA

    • This fundamental difference in respiratory metabolism affects how recombinant ATP6 integrates into the existing respiratory machinery

  • Expression regulation systems:

    • Expression of mtDNA genes in C. albicans involves pervasive transcription of the mitochondrial genome

    • RNA degradation by the mtEXO complex (consisting of Dss1p exoribonuclease and Suv3p helicase) is essential for shaping the mitochondrial transcriptome

    • These regulatory mechanisms may need to be considered when designing recombinant expression systems

What methodologies are most effective for studying ATP6 transcription and post-transcriptional regulation in Candida albicans?

Studying ATP6 transcription and post-transcriptional regulation in C. albicans requires sophisticated methodological approaches:

  • RNA isolation and quality assessment:

    • Isolation of mitochondria from log-phase liquid cultures grown in appropriate media (e.g., YPGal)

    • Extraction of high-quality mitochondrial RNA suitable for downstream applications

    • Quality assessment using tools such as BioAnalyzer to ensure RNA integrity

  • Transcriptome analysis:

    • Construction of mitochondrial RNA-seq libraries using techniques such as the Ion Total RNA-Seq Kit

    • Strategic modification of RNA fragmentation steps to preserve intact tRNAs and small RNAs

    • Next-generation sequencing on platforms such as Ion Torrent ProtonTM NGS System

    • Bioinformatic processing and mapping to reference genomes (e.g., C. albicans strain SC5314, GenBank:AF285261.1)

  • Analysis of bicistronic mRNA processing:

    • Northern blot analysis to detect the ATP8-ATP6 bicistronic mRNA

    • Investigation of proteins involved in maintaining bicistronic mRNA stability, such as CaAep3p

    • RT-PCR and qRT-PCR to quantify relative expression levels under various conditions

  • mtEXO complex function analysis:

    • Creation of deletion mutants lacking components of the mtEXO complex (DSS1 or SUV3)

    • Analysis of pervasive transcription in these mutants compared to wild-type strains

    • Detection of antisense ("mirror") transcripts that are absent in normal mitochondria but prominent in mtEXO mutants

  • Protein-RNA interaction studies:

    • RNA immunoprecipitation to identify proteins that interact with ATP6 mRNA

    • Investigation of PPR proteins that may be involved in regulating expression of mitochondrially encoded ATP synthase subunits

    • Cross-linking immunoprecipitation (CLIP) assays to map precise interaction sites

  • Genetic manipulation approaches:

    • Creation of reporter constructs to monitor ATP6 expression in vivo

    • Site-directed mutagenesis of potential regulatory sequences

    • Introduction of heterologous regulatory elements to assess functional conservation

How should researchers design experiments to investigate the role of ATP6 in Candida albicans pathogenicity?

Designing experiments to investigate ATP6's role in C. albicans pathogenicity requires a multifaceted approach:

  • Genetic manipulation strategies:

    • Creation of conditional mutants using inducible promoters to control ATP6 expression

    • Generation of point mutations in key functional domains to create partially functional variants

    • Construction of gene-reconstituted strains (atp6Δ/ATP6) as controls for complementation studies

  • In vitro virulence assays:

    • Biofilm formation assessment on various substrates

    • Adhesion to epithelial and endothelial cell lines

    • Hyphal morphogenesis under inducing conditions

    • Evaluation of stress resistance (oxidative, osmotic, pH)

  • Metabolic profiling:

    • Assessment of growth under various carbon sources (glucose, galactose, glycerol, lactate)

    • Measurement of oxygen consumption rates

    • Quantification of cellular ATP content under different growth conditions

    • Analysis of mitochondrial membrane potential (ΔΨm)

  • In vivo infection models:

    • Murine model of disseminated candidiasis to assess systemic virulence

    • Determination of fungal burden in target organs (kidney, liver, brain)

    • Histopathological examination of infected tissues

    • Survival curve analysis

  • Host-pathogen interaction studies:

    • Analysis of immune cell interactions (phagocytosis by macrophages and neutrophils)

    • Cytokine response profiling

    • Evaluation of host cell damage

  • Transcriptomic and proteomic approaches:

    • RNA-seq analysis to identify differentially expressed genes in ATP6 mutants

    • Proteomic profiling to assess changes in protein expression

    • Metabolomic analysis to identify altered metabolic pathways

What are the optimal conditions for purifying recombinant ATP6 from Candida albicans for structural studies?

Purification of recombinant ATP6 from C. albicans for structural studies presents several challenges due to its hydrophobic nature and mitochondrial membrane localization. The following protocol provides optimal conditions based on research with related ATP synthase subunits:

  • Expression system selection:

    • Heterologous expression in E. coli may be challenging due to codon usage differences and the hydrophobic nature of ATP6

    • Consider using a yeast expression system (S. cerevisiae or P. pastoris) with codon optimization

    • For native protein, extraction directly from C. albicans mitochondria is preferable

  • Extraction methodology:

    • Isolate intact mitochondria from C. albicans cultures

    • Use organic solvent mixtures for extraction of ATP6 from mitochondrial membranes

    • Based on studies with C. parapsilosis, a combination of chloroform/methanol/water can effectively extract ATP6

  • Purification strategy:

    • Initial purification using reverse-phase HPLC

    • For the C. parapsilosis ATP6 homolog, this approach successfully yielded purified protein

    • Consider adding a polyhistidine tag to facilitate purification if using recombinant systems

  • Buffer and detergent optimization:

    • Screen various detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Maintain pH between 7.0-8.0 to preserve protein stability

    • Include protease inhibitors to prevent degradation during purification

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Mass spectrometry for accurate molecular weight determination

    • N-terminal sequencing to verify post-translational processing

  • Structural preservation:

    • Consider mild cross-linking to stabilize native conformation

    • Explore nanodiscs or amphipols for maintaining membrane protein structure

    • For cryo-EM studies, optimize grid preparation conditions for membrane proteins

How does oxygen availability affect ATP6 expression and function in Candida albicans?

Oxygen availability significantly impacts ATP6 expression and function in C. albicans, reflecting the yeast's adaptation to diverse host microenvironments:

  • Transcriptional regulation:

    • Aerobic conditions generally support ATP6 expression as part of oxidative phosphorylation

    • Anaerobic or hypoxic conditions may lead to downregulation of ATP6 as cells shift to fermentative metabolism

    • Pervasive transcription of the mitochondrial genome occurs in mutants lacking mtEXO activity, suggesting complex oxygen-dependent regulatory mechanisms

  • Metabolic adaptation:

    • Under aerobic conditions, ATP6 is essential for effective utilization of non-fermentable carbon sources

    • ATP6 deletion mutants show immediate and sharp reduction in cell viability on non-fermentable carbon sources

    • This suggests ATP6 is critical for respiratory metabolism when oxygen is available

  • Heteroplasmy dynamics:

    • In heteroplasmic strains containing both wild-type and mutant mtDNA:

      • Aerobic conditions facilitate the loss of original mtDNA

      • Anaerobic conditions favor the loss of transformed mtDNA

    • This dynamic selection suggests differential fitness advantages depending on oxygen availability

  • ROS production patterns:

    • ATP6 deletion strains show complex patterns of ROS production under aerobic conditions:

      • Initially higher ROS levels (378.6% of wild-type after 8h)

      • Decreasing to below wild-type levels after prolonged aerobic growth (22.3% after 24h)

    • This temporal dynamic likely reflects adaptive responses to oxidative stress

  • Alternative respiratory pathways:

    • C. albicans cells lacking ATP6 function may upregulate alternative respiratory pathways:

      • Induction of alternative oxidase (AOX2) expression

      • Activation of parallel respiratory pathways that bypass standard electron transport chain components

    • These adaptations help cells respond to changing oxygen environments

  • Virulence implications:

    • During infection, C. albicans encounters varying oxygen tensions in different host tissues

    • ATP6 function appears critical for maintaining metabolic flexibility needed for adaptation to these diverse conditions

    • This flexibility is likely a key virulence determinant, explaining why ATP6 mutants display attenuated virulence in animal models

How might ATP6 be targeted for antifungal drug development against Candida albicans?

ATP6 presents a promising target for antifungal drug development against C. albicans based on several key attributes:

  • Essential function:

    • ATP6 is critical for oxidative phosphorylation and energy production

    • Deletion mutants show severely impaired growth and virulence

    • Targeting ATP6 would likely have fungicidal effects, particularly in non-fermentable carbon environments

  • Structural targeting approaches:

    • Develop small molecules that bind specifically to C. albicans ATP6

    • Target interaction surfaces between ATP6 and other F1Fo-ATP synthase components

    • Design peptidomimetics that disrupt ATP6 assembly into the complex

  • Expression inhibition strategies:

    • Target the processing and translation of the ATP8-ATP6 bicistronic mRNA

    • Disrupt proteins like CaAep3p that control expression of ATP8-ATP6 mRNA

    • Interfere with post-transcriptional regulatory mechanisms

  • Metabolic vulnerability exploitation:

    • Compounds that specifically inhibit ATP6 function could disrupt carbon flexibility

    • This disruption would prevent adaptation to glucose-limited host niches, a critical factor for C. albicans infection

    • Design drugs that are selectively activated in respiratory-dependent environments

  • Mitochondrial heteroplasmy manipulation:

    • Develop compounds that induce heteroplasmy or promote loss of functional mtDNA

    • Exploit the observation that aerobic conditions facilitate loss of original mtDNA in heteroplasmic strains

    • Create treatments that induce selective pressure against functional ATP6

  • Differential targeting rationale:

    • The ~52% similarity between C. albicans and S. cerevisiae ATP6 suggests sufficient divergence for selective targeting

    • Focus on unique structural features of C. albicans ATP6 not present in human ATP6

    • This approach could minimize off-target effects on host mitochondrial function

What is the relationship between ATP6 function and the development of drug resistance in Candida albicans?

The relationship between ATP6 function and drug resistance in C. albicans represents an emerging area of research with significant implications:

  • Metabolic adaptation mechanisms:

    • ATP6 is crucial for metabolic flexibility, particularly in utilizing non-fermentable carbon sources

    • This flexibility may contribute to survival under antifungal stress by enabling energy production through alternative pathways

    • ATP6-dependent metabolic adaptations could support cellular stress responses that contribute to drug resistance

  • Mitochondrial function and azole resistance:

    • Azole antifungals target ergosterol biosynthesis, which is linked to mitochondrial function

    • ATP6 dysfunction may alter membrane composition and fluidity, potentially affecting drug uptake or efflux

    • Changes in mitochondrial function can influence expression of drug efflux pumps (e.g., CDR1, CDR2)

  • ROS balance and antifungal response:

    • ATP6 deletion affects ROS production patterns

    • ROS levels influence cellular stress responses and adaptation to antifungal drugs

    • The temporal dynamics of ROS in ATP6 mutants (initially high, then below wild-type levels) may enable unique stress adaptation mechanisms

  • Alternative respiratory pathways and drug tolerance:

    • C. albicans cells lacking proper ATP6 function express higher levels of alternative oxidase (AOX2)

    • AOX expression has been linked to tolerance against certain antifungals

    • This compensatory respiration pathway may provide metabolic plasticity during drug exposure

  • Mitochondrial heteroplasmy and population resilience:

    • Heteroplasmic populations containing both wild-type and mutant ATP6 may exhibit increased population-level resilience

    • Under antifungal selection, cells with different mitochondrial genotypes might show differential survival

    • This genetic diversity could contribute to the emergence of resistant subpopulations

  • Biofilm formation implications:

    • ATP6 function may influence biofilm formation, a key resistance mechanism

    • Altered energy metabolism could affect the production of extracellular matrix components

    • Metabolic adaptations enabled by ATP6 might support persistence in biofilm environments where antifungal penetration is reduced

How does the interplay between nuclear and mitochondrial genomes regulate ATP6 expression in Candida albicans?

The complex interplay between nuclear and mitochondrial genomes in regulating ATP6 expression in C. albicans involves several sophisticated mechanisms:

  • Bicistronic mRNA processing:

    • ATP6 is expressed as part of a bicistronic ATP8-ATP6 mRNA in C. albicans

    • Nuclear-encoded proteins like CaAep3p are required to maintain this bicistronic mRNA

    • This represents a critical point of nuclear-mitochondrial coordination

  • PPR proteins in post-transcriptional regulation:

    • Nuclear-encoded pentatricopeptide repeat (PPR) proteins play essential roles in regulating mitochondrial gene expression

    • Several PPR proteins in C. albicans lack orthologs in S. cerevisiae, suggesting unique regulatory mechanisms

    • While some PPR proteins are specifically involved in Complex I expression, the regulatory principles may apply to ATP6 as well

  • mtEXO complex in RNA degradation:

    • The mitochondrial degradosome (mtEXO) consists of nuclear-encoded proteins (Dss1p and Suv3p)

    • This complex is essential for shaping the mitochondrial transcriptome

    • Deletion of either DSS1 or SUV3 results in pervasive transcription of the mitochondrial genome, affecting the expression of ATP6 and other genes

  • Coordinated respiratory complex assembly:

    • ATP6 incorporation into F1Fo-ATP synthase requires coordinated expression of both nuclear and mitochondrial-encoded subunits

    • Assembly factors encoded by the nuclear genome ensure proper complex formation

    • Disruption of this coordination can lead to respiratory deficiencies

  • Retrograde signaling pathways:

    • Mitochondrial dysfunction triggers retrograde signaling to the nucleus

    • This communication alters nuclear gene expression to adapt to mitochondrial status

    • Such signaling may influence nuclear genes involved in ATP6 processing or F1Fo-ATP synthase assembly

  • Environmental response coordination:

    • Oxygen availability and carbon source affect both nuclear and mitochondrial gene expression

    • The upregulation of alternative oxidase (AOX2) in ATP6-deficient cells demonstrates nuclear compensation for mitochondrial dysfunction

    • This response illustrates the dynamic cross-talk between the two genomes in maintaining cellular homeostasis

What are the most promising future research directions for understanding ATP6 function in Candida albicans?

Several promising research directions are emerging for deeper understanding of ATP6 function in C. albicans:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.