Recombinant Candida albicans C-5 sterol desaturase (ERG3)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Mechanism

The recombinant Candida albicans C-5 sterol desaturase (ERG3) is a key enzyme in ergosterol biosynthesis, catalyzing the conversion of lanosterol to ergosterol via the removal of a methyl group at the C-5 position of the sterol ring. This enzyme is critical for maintaining membrane integrity and fungal viability. ERG3 activity becomes pivotal under azole antifungal stress, as azoles inhibit lanosterol 14α-demethylase (ERG11), leading to the accumulation of toxic 14α-methylated sterol intermediates. ERG3 detoxifies these intermediates by converting them into non-toxic diols, a process that contributes to azole resistance when the enzyme is functional .

Key Biochemical Features:

PropertyDescriptionSource
Substrate SpecificityConverts 14α-methylergosta-8,24(28)-dien-3β-ol to 14α-methylergosta-8,24(28)-dien-3β,6α-diol
Azole Resistance MechanismDetoxifies azole-induced sterol intermediates, enabling fungal survival under azole pressure
Cross-Species ActivityERG3 homologs from Candida glabrata and Cryptococcus neoformans partially restore activity in C. albicans mutants

Role in Antifungal Resistance

Recombinant ERG3 studies reveal species-specific differences in azole resistance mechanisms. In C. albicans, loss of ERG3 function (via gene deletion or mutations) results in:

  • High-Level Azole Resistance: ERG3-deficient strains accumulate non-toxic 14α-methylfecosterol instead of toxic diols, enabling growth under azole conditions .

  • Species-Specific Variability: ERG3 homologs from Rhizopus delemar (RdERG3A) and Aspergillus fumigatus (AfERG3A) fail to restore azole sensitivity in C. albicans mutants, indicating divergent enzyme efficiencies .

Azole MIC Comparisons in C. albicans ERG3 Homologs:

SpeciesERG3 HomologFluconazole MIC (μg/ml)Sterol Diol Production
C. albicansCaERG30.25High
C. glabrataCgERG30.5Moderate
C. aurisCaurERG30.5Moderate
C. neoformansCnERG31.0Low
R. delemar (ERG3A)RdERG3A>64None

Key Insight: ERG3 functionality directly correlates with azole susceptibility. Non-functional homologs (e.g., RdERG3A) confer resistance due to impaired diol production .

Impact on Virulence and Pathogenesis

While ERG3 inactivation enhances azole resistance, its effects on virulence are context-dependent:

  • Reduced Virulence in Some Models: ERG3 mutants show attenuated colonization and dissemination in murine models of intestinal candidiasis, with lower histopathological damage and chemokine induction .

  • Preserved Virulence in Others: A clinical C. albicans ERG3 mutant (VSY2) retained wild-type virulence in disseminated candidiasis models, suggesting compensatory mechanisms (e.g., upregulation of efflux pumps or ergosterol biosynthetic bypass pathways) .

Virulence Outcomes in ERG3 Mutants:

ModelStrainVirulenceMechanism
Intestinal InfectionC. albicans ΔΔReduced colonization, mortalityImpaired gut invasion
Disseminated InfectionClinical ERG3ΔΔComparable to wild-typeCompensatory adaptations
Vaginal ColonizationERG3 mutantsNormal colonizationTissue-specific resilience

Critical Finding: ERG3’s role in virulence is organ-specific, with intestinal infections more sensitive to ERG3 loss than systemic infections .

Recombinant ERG3 in Cross-Species Studies

Recombinant ERG3 homologs have been expressed in C. albicans mutants to compare enzymatic activity and drug response:

  • Functional Restoration: C. glabrata and C. auris ERG3 homologs fully restore azole sensitivity in C. albicans ΔΔ mutants, while C. neoformans ERG3 confers partial restoration .

  • Structural Variability: A. fumigatus AfERG3C (60% identity to C. neoformans ERG3) shows divergent activity, highlighting evolutionary divergence in enzyme function .

Recombinant ERG3 Expression Systems:

Host OrganismPromoterPurposeOutcome
C. albicansTEF1Comparative analysis of ERG3 homologsDiverse azole MIC profiles
S. cerevisiaeConstitutiveBiochemical assays (e.g., substrate kinetics)Kinetic parameter determination

Methodological Note: Heterologous expression systems enable precise control of ERG3 activity, enabling direct comparisons of enzyme efficiency and substrate specificity .

Therapeutic Implications and Future Directions

ERG3’s dual role in resistance and virulence poses challenges for antifungal therapy:

  • Targeting ERG3: Inhibiting ERG3 could potentiate azole efficacy, but this may inadvertently increase resistance to other antifungals (e.g., echinocandins) .

  • Species-Specific Resistance: C. parapsilosis ERG3 mutations (e.g., G111R) confer cross-resistance to echinocandins, necessitating species-specific resistance monitoring .

Emerging Research Areas:

  1. Structural Biology: Crystallographic studies of ERG3 to identify binding pockets for inhibitors.

  2. Synergy Studies: Combining ERG3 inhibitors with azoles or echinocandins to overcome resistance.

  3. Viral Interactions: Exploring ERG3’s role in fungal-viral co-infections (e.g., C. albicans and HIV).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped standard with blue ice packs. If dry ice shipping is preferred, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ERG3; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Candida albicans (Yeast)
Target Names
ERG3
Target Protein Sequence
MDIVLEICDYYLFDKVYADVFPKDGAVHEFLKPAIQSFSQIDFPSLPNLDSFDTNSTLIS SNNFNISNVNPATIPSYLFSKIASYQDKSEIYGLAPKFFPATDFINTSFLARSNIFRETL SLFIITTIFGWLLYFIVAYLSYVFVFDKKIFNHPRYLKNQMSLEIKRATTAIPVMVLLTI PFFLLELNGYSFLYLDINECTGGYKAILWQIPKFILFTDCGIYFLHRWLHWPSVYKVLHK PHHKWIVCTPFASHAFHPVDGFFQSLPYHLYPLLFPLHKVLYLFLFTFVNFWTVMIHDGS YWSNDPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGNSYRRPDDSLFVKDVKAEEEKKIW KEQTRKMEEIRGEVEGKVDDREYVEQ
Uniprot No.

Target Background

Function
Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. This enzyme may play a role in regulating ergosterol biosynthesis.
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ERG3 and what role does it play in Candida albicans?

ERG3 encodes sterol C5,6-desaturase, an enzyme essential for the synthesis of ergosterol in Candida albicans. This enzyme introduces a C5,6 double bond in the B-ring of the sterol nucleus, which is a critical step in the downstream ergosterol biosynthesis pathway that occurs after the action of ERG11 (sterol 14α-demethylase). Ergosterol is vital for maintaining cell membrane integrity and fluidity in fungi, directly affecting their viability and pathogenicity . Mutations or knockout of ERG3 typically result in the accumulation of alternative sterols such as ergosta-7,22-dienol instead of ergosterol, which can significantly alter membrane properties and drug susceptibility .

How does ERG3 fit into the ergosterol biosynthesis pathway?

ERG3 functions in the late phase of the ergosterol biosynthesis pathway, downstream of ERG11. In the sequential process of ergosterol synthesis, sterol 14α-demethylase (ERG11) first removes the 14α-methyl group from lanosterol. Subsequently, ERG3 introduces a double bond between carbons 5 and 6 in the sterol B-ring. This step is crucial for the production of ergosterol, which is the predominant sterol in fungal cell membranes . When ERG3 is inactivated, the pathway is diverted to produce alternative sterols, primarily ergosta-7,22-dienol, which can serve as a biomarker for defective ERG3 function .

What phenotypic changes are associated with ERG3 mutations in Candida albicans?

ERG3 mutations in C. albicans lead to several significant phenotypic changes:

  • Altered sterol composition: ERG3-deficient strains accumulate ergosta-7,22-dienol (>5% of total sterol fraction) instead of ergosterol .

  • Azole resistance: ERG3 mutants typically display resistance to multiple azole antifungals, including fluconazole, voriconazole, itraconazole, ketoconazole, and clotrimazole .

  • Hyphal formation defects: ERG3-deficient strains show impaired hyphal formation both in vitro and in vivo kidney tissues .

  • Attenuated virulence: Knockout of ERG3 results in reduced virulence in mouse models, evidenced by longer survival times and lower kidney fungal burden .

  • Altered amphotericin B susceptibility: Strains with minimal ergosterol content (<2%) display reduced sensitivity to amphotericin B compared to wild-type strains .

What are the established methods for generating ERG3 knockout strains in Candida albicans?

The primary method for generating ERG3 knockout strains is the "Ura-blaster" technique combined with homologous recombination. This process involves:

  • Construction of knockout components: The process begins with amplifying the ERG3 open reading frame (ORF) using PCR with specific primers (e.g., Tg1 and Tg4) from genomic DNA of the target strain. This PCR product is then inserted into a plasmid containing the hisG-URA3-hisG cassette .

  • Sequential gene disruption: The knockout components are transfected into C. albicans using the lithium acetate transfection method. This results in the creation of heterozygous (ERG3+/-) strains. The process is then repeated to generate homozygous (ERG3-/-) knockout strains .

  • Selection process: Transformants are selected on minimal media plates for Ura+ phenotypes. Subsequently, 5-fluoroorotic acid (5-FOA) selection is used to obtain Ura- isolates resulting from cis-recombination between the hisG repeats .

  • Verification: The gene disruption is confirmed using Southern blotting with ERG3 or URA3 probes to ensure proper integration and knockout .

  • URA3 reintegration: To avoid positional effects on URA3 expression that might confound virulence studies, the wild-type URA3 gene is placed back into its native locus in the erg3 homozygote .

How can researchers validate the successful knockout of ERG3 in Candida albicans?

Validation of ERG3 knockout should employ multiple complementary approaches:

  • Molecular verification:

    • Southern blotting with ERG3 or URA3 probes to confirm the integration of the disruption cassette and the absence of the wild-type gene .

    • PCR analysis with specific primers that can distinguish between wild-type and knockout alleles.

  • Sterol profile analysis:

    • Gas chromatography-mass spectrometry (GC-MS) to analyze the sterol composition. ERG3-deficient strains typically show accumulation of ergosta-7,22-dienol (>5% of total sterol fraction) instead of ergosterol .

    • A successful ERG3 knockout strain will contain <2% ergosterol and significantly increased levels of alternative sterols .

  • Phenotypic confirmation:

    • Azole resistance testing: ERG3 knockout strains exhibit resistance to various azole drugs (fluconazole, voriconazole, itraconazole, etc.) .

    • Hyphal formation assays: ERG3-deficient strains show defective hyphal formation in vitro and in kidney tissues .

    • Virulence assessment in animal models: ERG3 knockout strains display attenuated virulence evidenced by longer survival and reduced kidney fungal burden in mice .

What advanced techniques are available for analyzing sterol composition in ERG3 mutants?

Sterol analysis is critical for characterizing ERG3 mutants, with several advanced techniques available:

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • This is the gold standard for sterol analysis, allowing precise identification and quantification of different sterol species.

    • Can detect even minor sterol components, enabling identification of "leaky" ERG3 mutations where some functional enzyme may still be present .

    • Enables detection of ergosta-7,22-dienol, which serves as a biomarker for defective Erg3p activity .

  • Liquid Chromatography-Mass Spectrometry (LC-MS):

    • Offers complementary information to GC-MS, particularly useful for thermolabile sterols.

    • Provides higher sensitivity for certain sterol derivatives.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Allows detailed structural analysis of individual sterol components.

    • Useful for characterizing novel sterols that may accumulate in various ERG mutants.

  • Sterol-specific staining and microscopy:

    • Filipin staining combined with fluorescence microscopy to visualize sterol distribution within the cell.

    • Enables assessment of not just sterol composition but also subcellular localization.

How does ERG3 mutation contribute to azole resistance in Candida albicans?

ERG3 mutations contribute to azole resistance through multiple mechanisms:

How can researchers distinguish between ERG3-mediated resistance and other azole resistance mechanisms?

Distinguishing between different resistance mechanisms requires a systematic approach:

  • Sterol profile analysis:

    • GC-MS analysis revealing >5% ergosta-7,22-dienol and reduced ergosterol indicates ERG3 dysfunction .

    • Wild-type isolates typically contain >80% ergosterol with undetectable levels of ergosta-7,22-dienol .

  • Efflux inhibition assays:

    • Testing azole susceptibility in the presence of efflux pump inhibitors like FK506.

    • True ERG3 mutants retain resistance even when efflux is inhibited, while strains relying on efflux-mediated resistance become susceptible .

  • Gene expression analysis:

    • Quantitative PCR (qPCR) to measure expression levels of resistance genes (CDR1, CDR2, MDR1, ERG11).

    • ERG3 mutants often show increased expression of these genes, but the primary resistance mechanism is sterol pathway alteration .

  • Sequence analysis:

    • Sequencing of ERG3 and ERG11 genes to identify mutations.

    • Clinical ERG3 mutants may harbor multiple amino acid substitutions in Erg3p (e.g., W332R in strain CA12) .

  • Cross-resistance patterns:

    • ERG3 mutants typically show broad resistance to multiple azoles, whereas other mechanisms may have more selective resistance profiles .

How do ERG3 mutations affect the virulence of Candida albicans in vivo?

ERG3 mutations significantly impact C. albicans virulence:

Why are ERG3 mutants rarely isolated from clinical settings despite their azole resistance?

Several factors contribute to the rarity of ERG3 mutants in clinical isolates:

  • Fitness cost: ERG3 mutations typically confer a significant fitness cost due to altered membrane composition, impaired hyphal formation, and reduced growth rates .

  • Attenuated virulence: As demonstrated in mouse models, ERG3-deficient strains show markedly reduced virulence, making them less likely to cause persistent infections that would be sampled clinically .

  • Detection challenges: Standard clinical laboratory methods focus on susceptibility testing rather than sterol profiling, potentially missing ERG3 mutations especially in "leaky" mutants where some functional enzyme remains .

  • Underestimation of prevalence: Recent research suggests ERG3 mutants may be more common than currently recognized, especially when sophisticated sterol analysis methods are employed. Some clinical isolates harbor mutations in both ERG3 and other resistance genes, creating complex phenotypes that may mask the ERG3 contribution .

  • Selection conditions: The specific selective pressures in vivo, including host immune responses and antifungal treatment regimens, may not favor the emergence of complete ERG3 loss-of-function mutants compared to other resistance mechanisms .

What clinical significance do "leaky" ERG3 mutations have compared to complete loss-of-function mutations?

"Leaky" ERG3 mutations (those retaining partial enzyme activity) have distinct clinical implications:

  • Balanced resistance-virulence profile: Unlike complete loss-of-function mutants, leaky ERG3 mutants may retain sufficient ergosterol synthesis to maintain some virulence while still providing moderate azole resistance, making them potentially more clinically relevant .

  • Difficult detection: These mutations are more likely to be missed by standard clinical laboratory methods since they may not exhibit the extreme sterol profiles or resistance patterns of complete knockout strains .

  • Evolutionary advantage: Leaky mutations may represent an evolutionary middle ground, allowing C. albicans to adapt to azole pressure while maintaining sufficient fitness to cause persistent infection .

  • Potential for compensatory mutations: Strains with partial ERG3 activity may be more likely to develop additional compensatory mutations that restore fitness while maintaining resistance, creating more problematic clinical isolates .

  • Treatment implications: The presence of leaky ERG3 mutations may explain cases of clinical treatment failure where standard susceptibility testing didn't predict resistance, highlighting the need for more comprehensive diagnostic approaches .

How can researchers effectively study the interplay between ERG3 mutations and other resistance mechanisms?

Investigating the complex interactions between ERG3 and other resistance mechanisms requires multifaceted approaches:

  • Combinatorial genetic manipulation:

    • Creating strains with controlled combinations of resistance mechanisms (e.g., ERG3 knockout plus ERG11 mutations or efflux pump overexpression).

    • Using CRISPR-Cas9 or traditional gene manipulation techniques to introduce specific mutations rather than complete gene knockouts.

  • Comprehensive resistance profiling:

    • Testing susceptibility against a wide range of antifungals with different mechanisms of action.

    • Employing checkerboard assays to identify synergistic or antagonistic interactions between drugs when targeting multiple mechanisms.

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify global transcriptional changes associated with ERG3 mutations and how they interact with other resistance mechanisms.

    • Proteomic studies to understand post-transcriptional regulatory effects that may not be apparent at the mRNA level.

  • Sterol metabolism flux analysis:

    • Using isotope-labeled precursors to track sterol biosynthesis pathway dynamics in various mutant backgrounds.

    • Quantifying the flux through different branches of the pathway under various conditions.

  • Clinical isolate characterization:

    • Detailed molecular and phenotypic characterization of clinical isolates with multiple resistance mechanisms.

    • Creating a database correlating genotypic features with resistance phenotypes to identify patterns and interactions.

What are the most effective experimental designs for studying ERG3 function in Candida albicans?

Optimal experimental designs for ERG3 research incorporate multiple complementary approaches:

  • Genetic manipulation strategies:

    • Compare complete knockout (ERG3-/-) with heterozygous mutants (ERG3+/-) and wild-type strains to assess gene dosage effects .

    • Create point mutants mimicking clinical mutations rather than just gene deletions to understand the effects of specific amino acid changes.

    • Use controllable promoters to modulate ERG3 expression levels rather than complete elimination.

  • Comprehensive phenotypic characterization:

    • Assess growth rates, morphology, and stress responses under various conditions.

    • Examine biofilm formation capacity, as this is a key virulence factor.

    • Investigate cell wall and membrane properties beyond just sterol composition.

  • In vivo models with appropriate controls:

    • Ensure proper control of URA3 positioning to avoid confounding effects on virulence studies .

    • Use multiple infection models (systemic infection, mucosal infection, biofilm formation) to assess different aspects of pathogenicity.

    • Consider implementing host variation (immunocompromised vs. immunocompetent) to model different clinical scenarios.

  • Drug susceptibility testing:

    • Test under both standard conditions and with efflux inhibitors to distinguish between different resistance mechanisms .

    • Include time-kill studies rather than just MIC determinations to capture dynamic aspects of drug responses.

    • Assess development of resistance during prolonged exposure to subinhibitory drug concentrations.

  • Integration of molecular and cellular techniques:

    • Combine sterol profiling with membrane fluidity and permeability assessments.

    • Correlate gene expression changes with protein levels and enzyme activities.

    • Use fluorescent reporters to monitor gene expression in real-time during drug exposure.

What contradictions exist in the current understanding of ERG3 function and how might researchers address them?

Several important contradictions and knowledge gaps exist in ERG3 research:

  • Virulence-resistance paradox:

    • Contradiction: ERG3 mutations confer azole resistance but attenuate virulence, yet some clinical isolates maintain both resistance and virulence.

    • Research approach: Investigate compensatory mutations that restore fitness while maintaining resistance, and characterize the specific conditions under which ERG3 mutants can persist in vivo despite reduced virulence.

  • Prevalence discrepancy:

    • Contradiction: Despite the relatively straightforward mechanism of ERG3-mediated resistance, these mutants are reported to be rare in clinical settings, yet recent studies suggest they may be more common than previously thought .

    • Research approach: Implement routine sterol profiling in clinical microbiology to better detect ERG3 mutations, especially "leaky" ones, and conduct large-scale surveillance studies using more sensitive detection methods.

  • Gene expression inconsistencies:

    • Contradiction: Reports vary regarding whether ERG3 mutations increase expression of other resistance genes, with some studies showing ERG11 overexpression while others report different patterns.

    • Research approach: Standardize gene expression analyses across studies and investigate strain-specific factors that might influence compensatory gene expression responses.

  • Mechanism of attenuated virulence:

    • Contradiction: While defective hyphal formation has been observed in ERG3 mutants , the exact molecular mechanisms linking sterol composition to hyphal development remain incompletely understood.

    • Research approach: Conduct detailed phosphoproteomic and metabolomic studies to identify signaling pathways affected by altered sterol composition that influence morphogenesis.

  • In vitro versus in vivo discrepancies:

    • Contradiction: Some studies show that despite in vitro resistance, certain ERG3 mutants remain responsive to azole treatment in vivo .

    • Research approach: Develop better in vitro models that more accurately reflect in vivo conditions, including serum components, pH variations, and oxygen tension differences that might affect drug efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.