Recombinant Candida albicans Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your process.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIC60; CAWG_01688; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-565
Protein Length
Full Length of Mature Protein
Species
Candida albicans (strain WO-1) (Yeast)
Target Names
MIC60
Target Protein Sequence
NIAPKVVSPPVPPPVKPQGSEIPPPPPPPPLKAKRFSLFGFLFKTTLLATVVYGGTLYAA TKNDKVMDFVIDKQLPFHEELIDLIENGSTEDLQEAWEQLKNKFTDVKLPTKDDIDELTQ KLEHRGEDIIKETKKKIASTHIGHKSGTDLTPTEQLQRGVEIESVKKDVAHLPLIELNSD LGKSVDETVKQTITSFNNFIQSIDASSLATKDDKLITSINTSVNQLASRLNSLTKDFDNE LQNKLKVSQTELFSSFTKKELELTENLLHQFSTEKQQLEAKLNQKLSQEIQAARAAISQA ASNAVAMVRIEQTKNFEKLVSEKLNEERNGRLANLEKLNDRIVELEKFAEGFETQIVSNH KKAIIHQAVSKLKSLLLAPAAGDKPQPIKPYIDELTKIATDDEVLALAIKDLSPLITNES THSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGVKEDGKDIE SVIGRVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLIESESKII
Uniprot No.

Target Background

Function

Recombinant Candida albicans Formation of Crista Junctions Protein 1 (FCJ1): A component of the MICOS complex, a large protein complex residing within the mitochondrial inner membrane. The MICOS complex plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and facilitating the formation of contact sites with the outer membrane. FCJ1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane and also facilitates protein import through the mitochondrial intermembrane space assembly (MIA) pathway.

Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Candida albicans FCJ1 and what is its role in mitochondrial structure?

FCJ1 (Formation of Crista Junctions protein 1) is a mitochondrial inner membrane protein that plays a critical role in determining mitochondrial architecture, particularly in the formation and stabilization of crista junctions (CJs). These junctions are tubular invaginations of the inner membrane that connect the inner boundary membrane with the cristae membrane . In Saccharomyces cerevisiae, FCJ1 has been shown to be preferentially located at CJs and is crucial for their formation, a function likely conserved in C. albicans . The protein is part of the larger MICOS/MINOS/MitOS complex that has a central role in determining cristae morphology . In C. albicans, proper mitochondrial function is essential for various cellular processes, including energy metabolism, virulence, and pathogenicity.

How does the C-terminal domain of FCJ1 contribute to protein function?

The C-terminal domain of FCJ1 is the most conserved part of the protein and is essential for its function in crista junction formation. Research in S. cerevisiae has demonstrated that:

  • The C-terminal domain mediates physical contact with the outer membrane via interaction with the TOB/SAM complex .

  • This domain is involved in FCJ1 oligomerization, as it can interact with full-length FCJ1 .

  • In the absence of the C-terminal domain, formation of CJs is strongly impaired, leading to irregular cristae structures including stacked cristae .

  • The C-terminal domain is required for the genetic interaction of FCJ1 with subunit e of the F1F0 ATP synthase, confirming its necessity for FCJ1 function .

The high conservation of this domain suggests that similar functional importance would be observed in C. albicans FCJ1.

What expression systems are optimal for producing recombinant C. albicans FCJ1?

Based on available data, the following expression systems have been successfully used for FCJ1:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid growthMay require optimization for proper folding of eukaryotic proteinsStructural studies, antibody production, interaction studies
Yeast systems (S. cerevisiae)Native-like post-translational modifications, proper foldingLower yield than bacterial systemsFunctional studies, complementation assays
Insect cellsComplex eukaryotic folding machineryMore expensive, longer production timeStructural studies requiring native conformation

For recombinant production, E. coli has been successfully used to express C. albicans FCJ1 with an N-terminal His-tag . When expressing in E. coli, researchers should consider:

  • Optimizing codon usage for bacterial expression

  • Expressing the mature protein (residues 26-565) without the mitochondrial targeting sequence

  • Using low temperature induction (16-20°C) to enhance proper folding

  • Adding solubility tags (His, GST, MBP) to improve protein solubility and facilitate purification

What purification strategies yield the highest purity of recombinant FCJ1?

A multi-step purification approach is recommended for obtaining high-purity recombinant FCJ1:

  • Initial capture: Nickel affinity chromatography for His-tagged FCJ1

    • Use buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole

    • Elute with imidazole gradient (50-300 mM)

  • Intermediate purification: Ion exchange chromatography

    • Anion exchange (Q-Sepharose) at pH 8.0 based on the protein's theoretical pI

  • Polishing step: Size exclusion chromatography

    • Separates monomeric FCJ1 from aggregates and oligomers

    • Provides information about the oligomerization state

  • Quality control:

    • SDS-PAGE analysis (>90% purity recommended)

    • Western blot using anti-His antibodies

    • Mass spectrometry for identity confirmation

For storage, lyophilization in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain protein stability . Aliquoting and storing at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles.

How can researchers assess the functional activity of purified recombinant FCJ1?

Functional assessment of recombinant FCJ1 should incorporate multiple complementary approaches:

  • Binding assays with known interaction partners:

    • Pull-down assays with recombinant TOB/SAM complex components

    • Surface Plasmon Resonance (SPR) to determine binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Oligomerization analysis:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation

    • Chemical cross-linking followed by SDS-PAGE and mass spectrometry

  • Complementation studies:

    • Expression of recombinant FCJ1 in FCJ1-knockout yeast strains

    • Assessment of mitochondrial morphology restoration

    • Evaluation of crista junction formation by electron microscopy

  • Structural integrity verification:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to evaluate protein stability

What experimental approaches can be used to study FCJ1's role in crista junction formation?

Several complementary approaches can be employed to investigate FCJ1's role in crista junction formation:

Research in S. cerevisiae has demonstrated that the absence of the C-terminal domain of FCJ1 leads to strongly impaired formation of crista junctions and the presence of irregular, stacked cristae . Similar approaches could be applied to C. albicans FCJ1 to determine conservation of function.

How does FCJ1 interact with the TOB/SAM complex in mitochondria?

The interaction between FCJ1 and the TOB/SAM (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery) complex represents a critical connection between the inner and outer mitochondrial membranes. Based on studies in S. cerevisiae:

  • Interaction mechanism:

    • The C-terminal domain of FCJ1 directly interacts with Tob55 (a component of the TOB/SAM complex)

    • This interaction helps position crista junctions in close proximity to the outer membrane

    • The association stabilizes CJs at specific sites on the inner membrane

  • Functional significance:

    • The presence of FCJ1 is required for the association of the TOB/SAM complex with contact sites

    • Down-regulation of the TOB/SAM complex leads to altered cristae morphology

    • This interaction explains how crista junctions are positioned at the outer membrane

  • Experimental approaches to study this interaction:

    • Co-immunoprecipitation with antibodies against FCJ1 and TOB/SAM components

    • Yeast two-hybrid assays with the C-terminal domain of FCJ1

    • Biolayer interferometry or surface plasmon resonance to measure binding kinetics

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners in vivo

The TOB/SAM complex is primarily involved in the insertion of β-barrel proteins into the outer membrane, but its interaction with FCJ1 suggests an additional role in determining cristae morphology .

How do mutations in the C-terminal domain of FCJ1 specifically affect mitochondrial morphology in C. albicans?

The C-terminal domain of FCJ1 is highly conserved and crucial for protein function. Advanced research on this domain would involve:

  • Structure-function analysis:

    • Generate a panel of point mutations in conserved residues within the C-terminal domain

    • Create truncation mutants removing specific portions of the C-terminal domain

    • Express these variants in FCJ1-null C. albicans strains

  • Phenotypic characterization:

    • Electron microscopy to assess crista junction number, distribution, and morphology

    • Quantitative analysis of mitochondrial network fragmentation/fusion

    • Assessment of inner membrane organization using membrane potential-sensitive dyes

  • Molecular consequences:

    • Analyze interaction with the TOB/SAM complex in each mutant

    • Evaluate FCJ1 oligomerization capacity

    • Determine localization patterns using fluorescently-tagged mutants

  • Physiological impacts:

    • Measure respiratory capacity and ATP production

    • Assess growth under various carbon sources

    • Evaluate stress resistance and virulence properties

Based on S. cerevisiae studies, we would expect mutations disrupting the C-terminal domain to result in:

  • Reduced number of crista junctions

  • Appearance of stacked, irregular cristae membranes

  • Impaired interaction with the TOB/SAM complex

  • Disrupted oligomerization of FCJ1

What role does FCJ1 play in C. albicans stress response and adaptation to host environments?

Understanding FCJ1's role in stress response and host adaptation represents an important research direction:

  • Response to oxidative stress:

    • Compare survival of wildtype and FCJ1-deficient strains under H₂O₂ challenge

    • Measure ROS production and detoxification enzyme activities

    • Analyze mitochondrial integrity during oxidative stress

  • Adaptation to nutrient availability:

    • Assess growth in media with different carbon sources (glucose, glycerol, etc.)

    • Monitor mitochondrial dynamics during metabolic shifts

    • Evaluate the impact on lipid droplet accumulation (a phenotype observed in other mitochondrial mutants)

  • Temperature adaptation:

    • Compare mitochondrial morphology at different temperatures (25°C, 30°C, 37°C, 42°C)

    • Measure FCJ1 expression levels under temperature stress

    • Assess thermal tolerance of FCJ1 mutants

  • Host-relevant stressors:

    • Resistance to antimicrobial peptides

    • Survival in macrophages

    • Growth in serum or tissue-mimicking conditions

This research direction is particularly relevant as C. albicans must adapt to diverse host environments during infection, and mitochondrial function is known to be important for virulence and stress adaptation in pathogenic fungi.

How does FCJ1 function compare between pathogenic Candida species and non-pathogenic yeasts?

Comparative analysis of FCJ1 across fungal species can provide insights into both conserved functions and pathogen-specific adaptations:

SpeciesFCJ1 HomologyMitochondrial FeaturesMetabolic Characteristics
C. albicansReferenceHighly dynamic mitochondriaMetabolic flexibility
S. cerevisiaeModerateWell-characterized cristaePreference for fermentation
C. glabrataModerateReduced mitochondrial genomeStrong fermentative capacity
C. parapsilosisHighElaborate mitochondriaEnhanced β-oxidation
C. tropicalisHighSimilar to C. albicansVersatile metabolism

Research approaches for this comparative analysis would include:

  • Evolutionary analysis:

    • Phylogenetic comparison of FCJ1 sequences across species

    • Identification of conserved domains and species-specific variations

    • Selection pressure analysis on different protein regions

  • Functional complementation:

    • Express FCJ1 from different Candida species in S. cerevisiae fcj1Δ strains

    • Determine the ability to restore wildtype mitochondrial morphology

    • Identify species-specific functional differences

  • Interaction network comparison:

    • Identify FCJ1 binding partners in different species

    • Compare MICOS complex composition

    • Analyze differences in interaction with respiratory complexes

  • Host-pathogen context:

    • Examine FCJ1 expression during infection models

    • Compare mitochondrial dynamics during phagocytosis

    • Assess the impact of FCJ1 deletion on virulence across species

Understanding species-specific adaptations in FCJ1 function could provide insights into the evolution of pathogenicity in Candida species and identify potential targets for species-specific therapeutic approaches.

What are the key challenges in studying mitochondrial proteins like FCJ1 in C. albicans?

Researchers face several unique challenges when studying mitochondrial proteins in C. albicans:

  • Genetic manipulation difficulties:

    • C. albicans is diploid, requiring disruption of both alleles

    • Lower transformation efficiency compared to S. cerevisiae

    • Limited availability of selection markers

    • Potential off-target effects during CRISPR-Cas9 applications

  • Mitochondrial isolation challenges:

    • Cell wall requires stronger digestion conditions

    • Risk of damaging mitochondrial integrity during isolation

    • Potential contamination with other organelles

    • Maintaining native protein interactions during fractionation

  • Morphological assessment complexities:

    • Distinguishing normal variation from mutant phenotypes

    • Quantifying subtle changes in cristae morphology

    • Standardizing growth conditions for consistent mitochondrial structure

    • Technical challenges in high-resolution imaging of fungal mitochondria

  • Functional relevance interpretation:

    • Connecting structural changes to physiological outcomes

    • Distinguishing direct from indirect effects of FCJ1 manipulation

    • Translating in vitro findings to in vivo significance

    • Accounting for compensatory mechanisms

Addressing these challenges requires combining multiple complementary approaches and careful experimental design with appropriate controls.

What advanced imaging techniques are most effective for studying FCJ1's role in mitochondrial ultrastructure?

Advanced imaging techniques provide crucial insights into FCJ1's role in mitochondrial architecture:

  • Electron microscopy approaches:

    • Transmission Electron Microscopy (TEM): The gold standard for visualizing cristae morphology and crista junctions

    • Electron Tomography: Provides 3D reconstruction of mitochondrial membranes at nanometer resolution

    • Immuno-gold labeling: Precisely localizes FCJ1 within the mitochondrial subcompartments

    • Cryo-electron microscopy: Visualizes structures in a near-native state without fixation artifacts

  • Super-resolution fluorescence techniques:

    • Structured Illumination Microscopy (SIM): ~100 nm resolution, good for live-cell imaging

    • Stimulated Emission Depletion (STED): ~30-70 nm resolution

    • Single-Molecule Localization Microscopy (PALM/STORM): ~20-50 nm resolution

    • Expansion Microscopy: Physically expands specimens for improved resolution

  • Correlative approaches:

    • Correlative Light and Electron Microscopy (CLEM): Combines fluorescence localization with ultrastructural context

    • Live-to-fixed cell imaging: Tracks dynamics then examines ultrastructure of the same cell

  • Live-cell imaging strategies:

    • Multi-color imaging: Simultaneously visualize FCJ1 and other mitochondrial markers

    • FRAP (Fluorescence Recovery After Photobleaching): Measures protein mobility

    • FRET (Förster Resonance Energy Transfer): Detects protein-protein interactions in live cells

For optimal results, researchers should employ a combination of these techniques and develop quantitative analysis workflows to measure parameters such as cristae density, crista junction diameter, and the distance between cristae membranes.

How can researchers integrate structural and functional data to understand FCJ1's role in mitochondrial physiology?

Integrating structural and functional data provides a comprehensive understanding of FCJ1's role:

  • Multi-omics integration approaches:

    • Combine proteomic data on FCJ1 interaction partners with structural studies

    • Correlate transcriptomic changes in FCJ1 mutants with observed phenotypes

    • Integrate metabolomic profiles with mitochondrial structural alterations

    • Use systems biology modeling to predict functional consequences of structural changes

  • Structure-guided functional analysis:

    • Use structural information to design targeted mutations in functional domains

    • Correlate specific structural features with discrete functional outcomes

    • Employ molecular dynamics simulations to predict effects of mutations

  • Temporal resolution strategies:

    • Track changes in mitochondrial structure and function during stress responses

    • Monitor FCJ1 dynamics during mitochondrial fission/fusion events

    • Follow functional parameters during FCJ1 depletion using inducible systems

  • Contextual analysis frameworks:

    • Compare FCJ1 function across different growth conditions

    • Analyze FCJ1 role during different developmental stages

    • Examine FCJ1 importance in various host-pathogen interaction scenarios

  • Quantitative correlation methods:

    • Establish quantitative relationships between cristae density and respiratory efficiency

    • Correlate crista junction numbers with metabolic parameters

    • Develop mathematical models of how structural parameters affect functional outcomes

By systematically integrating these approaches, researchers can move beyond descriptive characterizations to develop mechanistic models of how FCJ1-mediated structural organization translates to specific physiological functions in C. albicans mitochondria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.