Recombinant Candida albicans GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

ALG11 catalyzes the sequential transfer of α1,2-linked mannose residues from GDP-mannose to the LLO intermediate Man₃GlcNAc₂-PP-Dol, forming Man₅GlcNAc₂-PP-Dol . This dual function occurs in two steps:

  1. Man₃GlcNAc₂-PP-Dol → Man₄GlcNAc₂-PP-Dol

  2. Man₄GlcNAc₂-PP-Dol → Man₅GlcNAc₂-PP-Dol .

The reaction occurs on the cytosolic face of the ER, preceding the flipping of the LLO into the ER lumen for further processing . Mutations in ALG11 disrupt LLO synthesis, leading to hypoglycosylation of glycoproteins and congenital disorders of glycosylation (ALG11-CDG) .

Fungal Pathogenesis

  • ALG11 is critical for C. albicans cell wall integrity and virulence. Knockout strains show hypersensitivity to antifungal agents and attenuated virulence in murine models .

  • Used to study how glycosylation defects impair host-pathogen interactions, particularly immune evasion .

Human Disease Modeling

  • Recombinant ALG11 enables functional studies of ALG11-CDG, a rare autosomal recessive disorder characterized by developmental delays, seizures, and hypotonia .

  • In vitro assays using this enzyme help identify pathological mutations (e.g., p.Leu190Pro) that reduce mannosyltransferase activity .

Enzyme Mechanism Studies

  • Structural analyses reveal ALG11’s dependence on GDP-Man and divalent cations (e.g., Mn²⁺) for catalysis .

  • Chemoenzymatic synthesis of LLO intermediates aids in probing substrate specificity and inhibitor development .

Challenges in Recombinant Production

  • Solubility: Membrane-associated nature complicates purification; detergent optimization is required .

  • Stability: Requires trehalose and glycerol for long-term storage to prevent aggregation .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve ALG11’s transmembrane topology .

  • Therapeutic Screening: High-throughput assays to identify ALG11 activators for ALG11-CDG .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
ALG11; CAALFM_C602270CA; CaO19.10972; CaO19.3468; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Alpha-1,2-mannosyltransferase ALG11; Asparagine-linked glycosylation protein 11; Glycolipid 2-alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
Target Protein Sequence
MYLILLVVLAVYVTYKLITTVLPHHLLIPSQNWREKISYVVKYPKPIYLKVGTKRSSYRR RLILASENPAFYTNFINNKLKISPNDCENGDGFLNEMSRRDIDDPKRRIIYGFFHPYANN GGGGERVLWQAVKATLLADDKNICVIYTTNIEAQPLDILNKANKKFQIDGLDHSRVVFIY LRKFNNLIDGNYWKHFTLIGQLFGGILLSLEAMYELSPDVWIDTMGLPSSYLLVSLSLKI PILAYTHFPILQEDMFGKLKFQKLKDLWKFNIIKFNDYFALGKFIYWSILYYFYVYLGSK VNIALANGSWTFNHLSKIWVFNTALGNVLDVLYPPCGTEFLIKQANLNQPRSNKLLYLAQ FRPEKRHALLLKEYSNFLSNNFPNVTQITNKFPTLVFAGSCRTADDTATLKFLQEQVAKL DLSRFVEFRIDISYDEVVELLSSCKFGLNAMWNEHFGIGVVEYMARGCIPIVHASAGPLL DMIGRNDQQENCLNNWKTDGGFFFKSYDDPDLDPNLQKNTETGYIKFELFDQFIDYPTFE TLLKELYVNDPTIIEDSKLLKMRQIDQNRVAEKFSNKAFNKKWIEYINDLNTLEKQYREE KRTKVEQVY
Uniprot No.

Target Background

Function
Recombinant Candida albicans GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (ALG11) is essential for N-linked oligosaccharide assembly. This enzyme plays a role in the final step of synthesizing the Man(5)GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum.
Database Links
Protein Families
Glycosyltransferase group 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of C. albicans ALG11 protein?

C. albicans ALG11 functions as a mannosyltransferase involved in the synthesis of Man5GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum . This enzyme specifically catalyzes the addition of the fourth and fifth mannose residues in α-1,2 linkage during N-glycan precursor assembly. This process is critical for proper protein glycosylation, which affects protein folding, stability, and cellular localization. The glycosylation pathway is particularly important in C. albicans as it directly influences cell wall composition, a structure essential for fungal viability and pathogenicity. Experiments with conditional expression strains demonstrate that ALG11 disruption significantly impacts glycoprotein synthesis, affecting downstream biological processes including cell wall integrity and host interactions .

What is the structural composition of recombinant C. albicans ALG11?

Recombinant full-length C. albicans ALG11 protein consists of 609 amino acids (1-609aa) and is typically expressed with an N-terminal His-tag for purification purposes . The primary sequence contains multiple transmembrane domains consistent with its localization to the endoplasmic reticulum membrane. The full amino acid sequence is available in protein databases with accession number Q59S72 . The protein contains conserved domains characteristic of glycosyltransferase family members, including catalytic regions responsible for GDP-mannose substrate binding and transfer activities. When expressed in heterologous systems such as E. coli, the protein maintains its structural integrity though enzymatic activity may require proper folding and membrane association for full functionality .

How does ALG11 interact with other proteins in the N-glycosylation pathway?

ALG11 functions within a complex enzymatic cascade in the early stages of N-glycosylation. It specifically acts downstream of ALG3 and upstream of ALG9 in the dolichol-linked oligosaccharide assembly pathway. The protein interacts directly with ALG2 (which adds the second and third mannose residues) to ensure proper sequential addition of mannose residues. Research using mutant libraries has revealed that ALG11 disruption affects the expression and functionality of other glycosylation pathway components, creating a ripple effect throughout the glycosylation process . Interestingly, genome-wide screening shows that ALG11 conditional expression strains, similar to ALG1 mutants, exhibit abnormal interactions with host immune cells despite defects in hyphal formation, suggesting potential protein-protein interactions beyond the glycosylation pathway .

What are the optimal conditions for expressing recombinant C. albicans ALG11 protein?

For successful expression of recombinant C. albicans ALG11, E. coli expression systems have proven effective when using an N-terminal His-tag for purification . Optimal expression typically requires induction at lower temperatures (16-18°C) overnight to minimize inclusion body formation. The protein should be extracted under mild conditions using non-ionic detergents (such as 1% Triton X-100 or 0.5% DDM) to maintain the native conformation of this membrane-associated enzyme. After purification by nickel affinity chromatography, the protein is most stable when stored in Tris/PBS-based buffer at pH 8.0 with 6% trehalose . For long-term storage, it is recommended to add glycerol to a final concentration of 30-50% and store at -80°C in small aliquots to avoid repeated freeze-thaw cycles . Yield optimization may require codon optimization for E. coli expression and careful monitoring of cell density before induction.

What methods are most effective for studying ALG11 function in C. albicans?

Multiple complementary approaches have been developed to study ALG11 function in C. albicans. The GRACE (Gene Replacement and Conditional Expression) library system provides a powerful tool for creating conditional ALG11 mutants where expression can be controlled by tetracycline or doxycycline . This allows for temporal regulation of ALG11 expression to study both immediate and long-term effects of its depletion. Alternative approaches include CRISPR-Cas9 systems for precise gene editing and PiggyBac transposon insertion mutagenesis for randomized disruption . Phenotypic characterization should include analysis of cell wall composition (by flow cytometry with specific cell wall stains), protein glycosylation patterns (by lectin blotting), growth characteristics under various stressors, microscopic examination of cellular morphology, and host-pathogen interaction assays. Combining these approaches provides comprehensive insights into ALG11's multifaceted roles in fungal biology and pathogenicity.

How can researchers verify the enzymatic activity of purified recombinant ALG11?

Verification of ALG11 enzymatic activity requires specialized assays that monitor the transfer of mannose from GDP-mannose to the Man3GlcNAc2-PP-dolichol substrate. A reliable approach involves reconstituting the purified enzyme in proteoliposomes or detergent micelles containing synthetic lipid-linked oligosaccharide substrates. The reaction progress can be monitored by thin-layer chromatography, high-performance liquid chromatography (HPLC), or mass spectrometry to detect the addition of mannose residues. Radiolabeled GDP-[14C]mannose can also be used to enhance detection sensitivity. Control experiments should include heat-inactivated enzyme samples and reaction mixtures containing ALG11 inhibitors. Additionally, complementation assays in ALG11-deficient yeast strains provide functional validation by assessing whether the recombinant protein can rescue glycosylation defects in vivo. These complementary approaches ensure that the purified protein maintains its native enzymatic capabilities.

How does ALG11 contribute to C. albicans virulence and host-pathogen interactions?

Research using conditional expression mutants has revealed unexpected aspects of ALG11's contribution to C. albicans virulence. While ALG11 is critical for proper cell wall formation and glycoprotein synthesis, studies using the GRACE library surprisingly demonstrated that ALG11 conditional expression strains unable to form hyphae can still induce macrophage lysis . This finding challenges the traditional understanding that hyphal formation is necessary for C. albicans to escape from immune cells. Instead, the data suggests that ALG11's role in cell wall glycosylation patterns directly influences host-pathogen interactions, particularly through exposure of specific glycosylated proteins to macrophage phagosomes . This altered glycosylation appears to trigger macrophage pyroptosis independent of hyphal morphogenesis, revealing a novel virulence mechanism. Further studies have shown that the BCL10-MALT1 pathway in host cells is activated in response to these ALG11-dependent cell wall modifications, initiating inflammatory vesicle formation and programmed cell death .

What phenotypic changes occur in ALG11 mutants during interaction with host immune cells?

ALG11 mutants exhibit distinct phenotypic characteristics during interaction with host immune cells compared to wild-type C. albicans. Genome-wide screening using the GRACE library has demonstrated that tetO-ALG11/ALG11Δ conditional expression strains induce rapid pyroptosis in macrophages despite being deficient in hyphal formation . This pyroptosis is characterized by elevated IL-1β production and caspase-1 activation in host cells. The cell wall composition of ALG11 mutants shows significant alterations in mannan content and surface exposure of β-glucans, which are normally masked in wild-type cells. These altered pathogen-associated molecular patterns (PAMPs) are recognized by different pattern recognition receptors on immune cells, leading to modified immune signaling cascades. Time-course experiments reveal that ALG11 mutants are phagocytosed at normal rates but trigger accelerated inflammatory responses compared to morphogenesis-defective mutants of other genes, highlighting the specific and direct role of ALG11-dependent glycosylation in immune activation.

What makes ALG11 a potential antifungal drug target compared to other glycosylation enzymes?

ALG11 possesses several characteristics that make it an attractive antifungal drug target. First, unlike many other glycosylation enzymes, ALG11 has been identified as essential for C. albicans viability through comprehensive screening of the GRACE library . This essentiality reduces the likelihood of compensatory mechanisms developing when the protein is inhibited. Second, structural analysis reveals significant differences between fungal and human ALG11 homologs, particularly in key catalytic regions, providing opportunities for selective targeting. Third, ALG11 inhibition disrupts multiple downstream processes critical for fungal pathogenicity, including cell wall integrity, stress responses, and host-pathogen interactions. In heterozygous inhibition profiling (HIP) analyses, ALG11 mutants show hypersensitivity to certain compounds, suggesting potential synergies with existing antifungals . Finally, the localization of ALG11 to the cytoplasmic face of the ER membrane may provide advantages for drug accessibility compared to lumenal glycosylation enzymes. These factors collectively position ALG11 as a promising target in the development of novel antifungal strategies.

How can researchers design effective inhibitors targeting C. albicans ALG11?

Designing effective inhibitors for C. albicans ALG11 requires a multifaceted approach combining structural biology, computational modeling, and medicinal chemistry. The first step involves detailed characterization of ALG11's catalytic domains and substrate binding sites through techniques such as X-ray crystallography or cryo-electron microscopy, although membrane protein crystallization presents significant challenges. In the absence of crystal structures, homology modeling based on related glycosyltransferases provides an alternative starting point. Substrate-based design strategies can focus on developing GDP-mannose analogs that compete for the active site or transition state mimics that inhibit the transfer reaction. High-throughput screening of chemical libraries against purified recombinant ALG11 can identify lead compounds for further optimization. Fragment-based approaches may also prove effective by identifying smaller molecular scaffolds with binding affinity that can be elaborated into more potent inhibitors. Importantly, selectivity over human homologs should be prioritized through comparative analysis of binding pockets and rational design of fungal-specific interactions. Validation of promising compounds should include enzyme inhibition assays, cell-based glycosylation assessments, and evaluation of growth inhibition across multiple Candida species.

What are the implications of ALG11 research for understanding eukaryotic N-glycosylation pathways?

Research on C. albicans ALG11 has broader implications for understanding fundamental aspects of eukaryotic N-glycosylation. Studies using the GRACE library and other mutant collections have revealed unexpected roles for early N-glycosylation events in processes beyond protein folding and quality control . The finding that ALG11 deficiency alters host-pathogen interactions independent of morphological changes suggests novel functions for specific N-glycan structures in immune signaling. This has prompted re-examination of N-glycosylation in other eukaryotic systems, revealing previously unrecognized relationships between glycan structure and cellular communication. Furthermore, the essential nature of ALG11 in C. albicans contrasts with the viability of alg11 mutants in some other fungi, highlighting species-specific adaptations in glycosylation pathways. Comparative genomic analyses across fungal lineages show varying degrees of conservation in ALG11 sequence and regulation, providing insights into the evolution of glycosylation machinery. These findings connect C. albicans ALG11 research to broader questions in glycobiology and suggest experimental approaches that may be applicable to studying N-glycosylation across diverse eukaryotic systems.

How does C. albicans ALG11 differ structurally and functionally from its homologs in other fungal species?

Comparative analysis reveals significant differences in both structure and function of ALG11 across fungal species. While the catalytic domain responsible for mannosyltransferase activity is relatively conserved, C. albicans ALG11 (609 amino acids) contains unique flanking regions and regulatory elements not present in other species . These C. albicans-specific regions may contribute to differences in enzymatic efficiency, substrate specificity, or protein-protein interactions. Functionally, genome-wide screening has demonstrated that ALG11 is essential in C. albicans, whereas some other fungal species can tolerate its deletion with varying degrees of growth defects . The contribution of ALG11 to pathogenicity also differs; in C. albicans, ALG11 mutants show dramatic effects on host-pathogen interactions independent of hyphal formation, a phenotype not consistently observed in other pathogenic fungi . These differences likely reflect adaptations to specific ecological niches and virulence strategies. Understanding these distinctions is crucial for both fundamental glycobiology research and targeted drug development efforts.

What advanced techniques can be applied to study ALG11 localization and dynamics in living C. albicans cells?

Advanced microscopy and molecular biology techniques provide powerful approaches for investigating ALG11 localization and dynamics in living C. albicans cells. CRISPR-Cas9 genome editing can be used to introduce fluorescent protein tags (such as mNeonGreen or mScarlet) at the native ALG11 locus, ensuring physiological expression levels . Super-resolution microscopy techniques including structured illumination microscopy (SIM) or stochastic optical reconstruction microscopy (STORM) can then resolve the precise suborganellar localization of ALG11 within the ER membrane. For studying protein dynamics, techniques such as fluorescence recovery after photobleaching (FRAP) or photoactivatable fluorescent proteins can measure ALG11 mobility and turnover rates within membranes. Proximity labeling approaches using APEX2 or TurboID fusions can identify proteins in close spatial proximity to ALG11, revealing its interaction network. For temporal dynamics during different growth phases or stress responses, microfluidic systems combined with time-lapse microscopy allow continuous monitoring of ALG11 localization changes in response to environmental perturbations. These complementary approaches provide unprecedented insights into the spatial and temporal regulation of ALG11 in living fungal cells.

What are promising future research directions for understanding ALG11's role in fungal biology and developing targeted therapeutics?

Several promising research directions will advance understanding of ALG11's role in fungal biology and therapeutic development. First, cryo-electron microscopy studies of membrane-embedded ALG11 would provide critical structural insights for rational drug design. Second, comprehensive glycomics analysis comparing wild-type and ALG11-depleted cells would reveal the full spectrum of glycosylation changes and their functional consequences. Third, investigating potential post-translational modifications and regulatory mechanisms controlling ALG11 activity could identify additional intervention points. Fourth, expanding comparative studies across clinically relevant Candida species (including emerging threats like C. auris) would establish the conservation of ALG11 functions and their relationship to virulence. Fifth, developing cell-penetrating ALG11 inhibitors based on nucleotide-sugar analogs represents a promising therapeutic approach. Finally, exploring combination therapies targeting ALG11 alongside other cell wall-targeting agents could yield synergistic effects by simultaneously disrupting multiple aspects of fungal cell integrity. These directions collectively hold potential for both fundamental discoveries in glycobiology and practical applications in antifungal development targeting this essential enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.