Recombinant Candida albicans Glycosylphosphatidylinositol anchor biosynthesis protein 11 (GPI11)

Shipped with Ice Packs
In Stock

Description

Role in GPI Biosynthesis Pathway

GPI11 is an essential subunit of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex, which catalyzes the first step of GPI anchor biosynthesis in C. albicans . This pathway is critical for anchoring virulence factors (e.g., adhesins, hydrolases) to the fungal cell wall . GPI11 interacts with other subunits (e.g., GPI2, GPI19) to regulate:

  • Ergosterol biosynthesis: Mutants of GPI11 homologs alter ERG11 expression, impacting azole drug resistance .

  • Hyphal morphogenesis: GPI-GnT subunits cross-talk with Ras1 signaling to control filamentation .

Production and Biochemical Insights

The recombinant GPI11 protein is produced via heterologous expression in E. coli, enabling functional studies of its enzymatic activity. Key findings include:

  • Activity assays: GPI11 participates in the transfer of GlcNAc to phosphatidylinositol (PI), forming GlcNAc-PI .

  • Mutational analysis: Conditional null mutants of GPI11 homologs (e.g., GPI2, GPI19) reduce GPI anchor levels by 50–70%, leading to cell wall defects and altered drug responses .

Functional Implications in Antifungal Strategies

GPI11 is a potential target for antifungal agents due to its role in GPI-dependent virulence. Key research highlights:

  • Inhibitor studies: Compounds like E1210 and 11g block fungal GPI biosynthesis by targeting upstream enzymes (e.g., Gwt1p), indirectly validating GPI11’s importance .

  • Immune modulation: GPI anchor disruption by 11g unmasks β-glucan layers, enhancing macrophage-mediated fungal clearance .

Applications in Research and Drug Development

Recombinant GPI11 is utilized for:

  • Enzymatic assays: To screen GPI biosynthesis inhibitors .

  • Structural studies: Mapping interactions with other GPI-GnT subunits .

  • Vaccine development: GPI-anchored proteins are immunogenic candidates for antifungal vaccines .

Challenges and Future Directions

While recombinant GPI11 enables mechanistic studies, challenges persist:

  • Functional redundancy: Cross-talk with Ras and ergosterol pathways complicates targeted inhibition .

  • Species specificity: GPI11 homologs in C. albicans differ structurally from human PIG-W, offering therapeutic selectivity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPI11; CAALFM_C402420CA; CaO19.10277; CaO19.2761; Glycosylphosphatidylinositol anchor biosynthesis protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
GPI11
Target Protein Sequence
MPAAIRPMKKTVSFSKDVSNNNNNLESDSDTKQSPQSYLTFIPQIKNSLLVVPFHNIFIL VGMFYSGLTQDLETVMWKGFLTSIPIQVIYNYIIYINLLPLKKSTRNDHQNNSSGSAINN NNNNNNNNVPLLIGSSIFVSIVLSLPLFVVIILMGAPVYKYSLKTLYLSLHLSQLIFNPL IILSNLNVNKIKRLFKQDHLYRIIFHHGILSSVLLTLGGCWLGVIPIPLDWDRPWQQWPI TLLVGGYLGGVVGGVLSLIVNYFSH
Uniprot No.

Target Background

Function

Functions in the GPI biosynthetic pathway, mediating steps between GlcNAc-PI synthesis and GPI transfer to proteins.

Database Links
Protein Families
PIGF family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of GPI11 in the GPI anchor biosynthesis pathway of C. albicans?

GPI11 is involved in the later stages of GPI anchor biosynthesis, specifically in the processing of the GPI precursor after the initial synthesis steps. Based on its homology to Saccharomyces cerevisiae GPI11, it likely functions in the ER lumen as part of the GPI-anchor transamidase complex that catalyzes the attachment of the GPI anchor to proteins . Unlike the earlier steps involving GPI-GnT complex subunits (GPI2, GPI19, etc.), GPI11 functions downstream in the pathway and is critical for the maturation of GPI-anchored proteins that eventually localize to the cell wall and contribute to virulence .

How is GPI11 structurally and functionally different from other GPI biosynthesis proteins like GPI2 and GPI19?

Unlike GPI2 and GPI19, which are involved in the first step of GPI anchor biosynthesis (the transfer of GlcNAc from UDP-GlcNAc to phosphatidylinositol), GPI11 functions in the later processing steps. Structurally, GPI11 likely contains transmembrane domains that anchor it to the ER membrane, with its catalytic domain facing the ER lumen.

The key functional differences are:

  • GPI2/GPI19 function in the GPI-GnT complex that initiates GPI synthesis

  • GPI11 likely functions in processing the glycan core or in the attachment process

  • GPI2/GPI19 display mutual transcriptional regulation and cross-talk with ergosterol biosynthesis and Ras signaling , whereas such regulatory relationships have not been established for GPI11

What are the optimal conditions for expressing recombinant C. albicans GPI11 in heterologous systems?

For successful expression of recombinant C. albicans GPI11:

  • Expression system selection:

    • E. coli: Challenging due to the multiple transmembrane domains and potential glycosylation. Use specialized strains like Rosetta-gami with pET vectors containing a C-terminal His-tag.

    • Pichia pastoris: Preferred for maintaining proper folding and post-translational modifications. Use pPICZ vectors with an inducible AOX1 promoter.

    • S. cerevisiae: Ideal for functional studies, particularly in gpi11 mutant backgrounds for complementation experiments .

  • Expression conditions:

    • Temperature: 25-30°C (lower temperatures may improve folding)

    • Induction: Gradual induction protocols to prevent aggregation

    • Membrane solubilization: Use detergents like DDM (n-Dodecyl β-D-maltoside) or CHAPS for extraction

  • Purification approach:

    • Two-step purification involving affinity chromatography followed by size exclusion

    • Addition of glycerol (10%) and reducing agents to maintain stability

How can researchers generate conditional mutants of GPI11 in C. albicans for functional studies?

Since GPI11 is likely essential (based on homology with other fungi), conditional mutants are necessary for functional studies:

  • Tetracycline-regulatable system:

    • Replace one allele with a selectable marker

    • Place the second allele under control of the tetracycline-repressible promoter (TetR-pTET)

  • Methionine/Cysteine-regulatable system:

    • Similar to the approach used for GPI2 studies, place GPI11 under the MET3 promoter

    • Repress expression by growing in media containing methionine and cysteine (10mM)

  • CRISPR-Cas9 approach:

    • Use for precise gene editing and promoter replacement

    • Include unique barcodes for tracking in mixed populations

How does GPI11 depletion affect C. albicans virulence compared to depletion of other GPI biosynthesis proteins?

GPI11 depletion likely has profound effects on virulence:

GPI GeneMorphology EffectsAzole SensitivityCell Wall EffectsVirulence Impact
GPI2Reduced filamentation due to reduced Ras1 activityResistant (↑ERG11)Reduced GPI anchor incorporationReduced macrophage killing
GPI19Enhanced filamentationSensitive (↓ERG11)Altered GPI-APs distributionNot fully characterized
GPI15HypofilamentousSensitiveMaster activator of GPI2/GPI19Reduced ability to damage host cells
GPI11 (predicted)Impaired hyphal formationLikely sensitiveSevere defects in GPI-AP maturationLikely strongly attenuated

Based on studies of other GPI biosynthesis proteins and considering GPI11's likely essential role, its depletion would:

  • Severely impair cell wall integrity

  • Reduce virulence-associated GPI-anchored proteins on the cell surface

  • Diminish adherence to host tissues

  • Increase susceptibility to host immune defenses

What role does GPI11 play in biofilm formation and host immune evasion?

GPI11 likely plays a critical role in biofilm formation through its function in GPI anchor biosynthesis:

  • Biofilm formation impacts:

    • Proper localization of adhesins like Als1p and Als3p depends on functional GPI anchoring

    • Inhibition of GPI biosynthesis (as seen with compound 11g) reduces biofilm formation

    • GPI-anchored proteins like Ywp1p and Pga10p, which play key roles in biofilm formation, would be mislocalized when GPI11 is compromised

  • Immune evasion mechanism:

    • GPI anchoring maintains proper cell wall architecture, masking immunogenic β-(1,3)-glucan

    • Disruption of GPI biosynthesis (as with compound 11g or BST1 deletion) leads to β-glucan exposure

    • Increased β-glucan exposure enhances recognition by Dectin-1 receptors on immune cells

    • This results in stronger TNFα production by macrophages

    • GPI11 disruption would likely cause similar immunostimulatory effects

How conserved is GPI11 across fungal species, and what can comparative genomics tell us about its function?

GPI11 shows significant conservation across fungal species, with important implications:

  • Conservation analysis:

    • High sequence conservation in the catalytic domain across pathogenic Candida species

    • More divergence in N-terminal regions that may mediate species-specific interactions

    • Core functional domains are conserved from S. cerevisiae to C. albicans

  • Functional implications from comparative genomics:

    • Essential function across fungi (as demonstrated for GPI genes in Colletotrichum graminicola)

    • C. albicans contains nearly twice as many GPI-anchored proteins as S. cerevisiae , suggesting potentially expanded or specialized roles for its GPI biosynthesis machinery

    • Unlike S. cerevisiae, C. albicans shows unique transcriptional cross-talk between GPI biosynthesis components and virulence pathways

  • Structural conservation:

    • Key catalytic residues are highly conserved

    • C. albicans GPI11 likely maintains the same membrane topology as its S. cerevisiae homolog

How does the research methodology for studying GPI11 differ between C. albicans and other model organisms?

Methodological AspectC. albicansS. cerevisiaeImplications for Research
Genetic manipulationMore challenging (diploid)Straightforward (haploid)Requires two-step gene deletion in C. albicans
Expression systemsSpecialized vectors with C. albicans codon optimizationStandard yeast vectorsNeed for custom expression constructs
Phenotypic assaysFocus on virulence traits (hyphal formation, biofilm)Focus on general growthDifferent readouts for functional studies
In vivo modelsMammalian infection modelsLimited relevance to pathogenesisC. albicans studies require animal models
Transcriptional analysisMust account for unique regulatory networksWell-characterized pathwaysNeed to consider cross-talk with other pathways

How can researchers leverage GPI11 for the development of novel antifungal strategies?

GPI11 presents several promising avenues for antifungal development:

  • Structure-based drug design approaches:

    • Generate high-resolution structures of GPI11 using cryo-EM or X-ray crystallography

    • Identify unique structural features absent in human homologs

    • Design specific inhibitors targeting catalytic pockets

  • Immunotherapeutic strategies:

    • GPI11 inhibition leads to β-glucan exposure and enhanced immune recognition

    • Combine sub-inhibitory concentrations of GPI11 inhibitors with immune modulators

    • This "chemically-induced attenuation" approach could be used for developing live attenuated vaccines

  • Potential advantages over current antifungals:

    • Novel mechanism of action distinct from azoles, echinocandins, and polyenes

    • Dual activity: direct antifungal effect plus immunomodulatory properties

    • Targeting a pathway essential for virulence may reduce selection pressure for resistance

What are the experimental challenges in studying the interactome of GPI11 in C. albicans?

Studying the GPI11 interactome presents several technical challenges:

  • Membrane protein complexes challenges:

    • GPI11 is likely membrane-bound, complicating isolation of intact complexes

    • Extraction requires careful optimization of detergents

    • Native interactions may be disrupted during solubilization

  • Recommended approaches:

    • Proximity-based labeling techniques (BioID or APEX2) fused to GPI11

    • In situ crosslinking prior to extraction

    • Split-reporter systems to verify specific interactions

  • Validation strategies:

    • Co-immunoprecipitation with epitope-tagged proteins

    • Fluorescence resonance energy transfer (FRET) for direct interaction studies

    • Genetic interaction mapping through epistasis analysis

How does the transcriptional regulation of GPI11 integrate with other virulence pathways in C. albicans?

Understanding GPI11 regulation within virulence networks:

  • Regulatory connections:

    • Based on studies of other GPI biosynthesis genes, GPI11 may be regulated by transcription factors involved in:

      • Morphogenesis (Efg1, Cph1)

      • Cell wall integrity (Rlm1, Cas5)

      • Stress response (Hsf1)

    • Potential regulatory relationship with Ras signaling, as seen with GPI2

  • Chromatin-level regulation:

    • Histone acetylation by Rtt109 affects the expression of GPI biosynthesis genes

    • GPI11 promoter likely shows similar regulation patterns

  • Experimental approaches to study integration:

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to GPI11 promoter

    • Reporter gene assays with GPI11 promoter under various conditions

    • Epistasis analysis with key regulators of virulence pathways

    • RNA-seq analysis comparing wild-type and mutant strains under different conditions

How might single-cell analysis techniques advance our understanding of GPI11 function during C. albicans infection?

Single-cell approaches offer new insights into GPI11 function:

  • Single-cell transcriptomics applications:

    • Reveal heterogeneity in GPI11 expression within C. albicans populations during infection

    • Identify subpopulations with distinct GPI biosynthesis patterns

    • Correlate GPI11 expression with other virulence factors at single-cell level

  • Spatial transcriptomics potential:

    • Map GPI11 expression in different microenvironments during infection

    • Correlate with host tissue responses

    • Identify spatial patterns of GPI biosynthesis regulation

  • Live-cell imaging approaches:

    • GPI11-fluorescent protein fusions to track localization during morphological transitions

    • Biosensors to monitor GPI biosynthesis activity in real-time

    • Correlate with virulence-associated behaviors

What are the prospects for using CRISPR-Cas9 technology to study GPI11 function in C. albicans?

CRISPR-Cas9 offers powerful approaches for GPI11 research:

  • Gene editing applications:

    • Generation of conditional mutants with improved precision

    • Domain-specific mutations to probe structure-function relationships

    • Introduction of epitope tags at endogenous locus

  • CRISPR interference (CRISPRi) approach:

    • Tunable repression of GPI11 without genetic modification

    • Study partial loss-of-function phenotypes

    • Examine dosage effects on virulence

  • CRISPR activation (CRISPRa) potential:

    • Upregulate GPI11 to assess effects of overexpression

    • Study compensatory mechanisms when other GPI pathway components are inhibited

    • Investigate genetic interactions through combinatorial activation/repression

How do researchers reconcile conflicting data on the roles of GPI biosynthesis proteins in drug resistance and virulence?

The contradictory findings in GPI biosynthesis research require careful interpretation:

  • Contradictory drug sensitivity phenotypes:

    • GPI2 mutants are azole-resistant due to upregulation of ERG11

    • GPI19 mutants are azole-sensitive due to downregulation of ERG11

    • GPI15 mutants (which regulate both GPI2 and GPI19) are azole-sensitive

    • Explanation: These contradictions reflect the complex transcriptional cross-talk between GPI biosynthesis genes and ergosterol biosynthesis, with different components having opposing regulatory effects

  • Discrepancies between species:

    • In S. cerevisiae, Ras signaling represses GPI biosynthesis

    • In C. albicans, Ras1 activates GPI-GnT activity

    • Resolution approach: These differences highlight species-specific adaptations of the pathway and underscore the need for direct experimental verification in C. albicans rather than extrapolation from model yeasts

  • Experimental approaches to resolve contradictions:

    • Generate and characterize double mutants to establish epistatic relationships

    • Perform time-course experiments to capture dynamic regulatory changes

    • Use systems biology approaches to model the entire regulatory network

What are the methodological considerations for differentiating direct versus indirect effects when studying GPI11 function?

Distinguishing direct from indirect effects requires careful experimental design:

  • Control strategies:

    • Use multiple independent mutant alleles or depletion methods

    • Include rescue experiments with wild-type GPI11

    • Conduct time-course studies to establish order of events

    • Include isogenic controls with mutations in different pathway components

  • Biochemical verification approaches:

    • In vitro reconstitution of GPI11 activity

    • Direct substrate binding assays

    • Structure-guided mutagenesis of catalytic residues

  • Systems-level analysis:

    • Network-based approaches to distinguish primary from secondary effects

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Mathematical modeling to predict direct versus indirect consequences of GPI11 perturbation

Comparison of GPI11 homologs across species

OrganismGene/Protein% Identity to C. albicansKey Structural FeaturesRole in Pathogenesis
S. cerevisiaeScGPI11~60-70% (predicted)ER membrane proteinNon-pathogenic
C. glabrataCgGPI11~70-80% (predicted)Similar to C. albicansContributes to virulence
A. fumigatusAfGPI11~40-50% (predicted)More divergent structureImportant for cell wall integrity
C. neoformansCnGPI11~35-45% (predicted)Significantly divergentRequired for virulence
HumansPIGG~25-30% (predicted)Different domain organizationN/A (host protein)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.