Recombinant Candida albicans Golgi apparatus membrane protein TVP23 (TVP23)

Shipped with Ice Packs
In Stock

Description

Research Applications

The recombinant TVP23 protein serves as a tool for:

  • Protein Interaction Studies: Identifying binding partners (e.g., YIPF6 in mammals) .

  • Enzyme Localization Assays: Investigating Golgi-resident glycosylation machinery .

  • Structural Biology: Characterizing transmembrane domains and topology.

Expression and Purification

  • Recombinant TVP23 is produced in E. coli with high yield (>90% purity) and stability under optimized storage conditions .

  • Reconstitution requires sterile water and glycerol (5–50%) for long-term storage .

Functional Insights from Homologs

OrganismFunctionReference
S. cerevisiaeRetrograde transport regulation; genetic interaction with SNARE Vti1
Mus musculus (TVP23B)Intestinal homeostasis via mucin glycosylation and Paneth cell function
Arabidopsis thalianaSecretory trafficking and cell elongation

Limitations and Future Directions

  • Direct Functional Data: No studies have yet characterized C. albicans TVP23’s role in pathogenesis or glycosylation.

  • Therapeutic Potential: TVP23 homologs in mammals are linked to inflammatory bowel disease , suggesting conserved roles worth exploring in fungal-host interactions.

References

  1. Recombinant Candida albicans TVP23 product overview (Creative Biomart, 2025).

  2. Trans-Golgi protein TVP23B regulates intestinal host-microbe interactions (PubMed, 2023).

  3. Immunoisolation of yeast Golgi subcompartments (NCBI, 2005).

  4. TVP23B’s role in glycosylation and colitis (Nature Communications, 2023).

  5. TVP23-Vti1 genetic interaction in retrograde transport (Biochemical Journal, 2009).

  6. TVP23’s role in Golgi-endosome trafficking (Semantic Scholar, 2009).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
TVP23; CAALFM_C109950CA; CaO19.12326; Golgi apparatus membrane protein TVP23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
TVP23
Target Protein Sequence
MNSSYTAIEPDEPLDSPPSYSANDHNTTTNTTTSNPSTQPYVNQPQADQPQQPGTSSSFE PRTLLQRLKESSHPIALLFYIFFRVSPIVTYIFGTIVIHQFTSKNTFILHFIVLILLVAG DFWNLKNISGRLLVGLRWWNETTLIESENGNGNGNASGQVGESAKDFENVWVFETADPNR YINPIDSKVFWLLLYGQPVAWVVLGVLAVLKLQFLYLLFIIVATSLSMTNAMAFTKCDKF GKANNFANDVFTRAAGSMFNNFNPFGR
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP23 and where is it primarily localized?

TVP23 (Trans-Golgi apparatus membrane protein TVP23) is a transmembrane protein conserved from yeast to humans, including Candida albicans . It is primarily localized in the Trans-Golgi network where it plays essential roles in membrane trafficking and protein glycosylation . The protein contains multiple transmembrane domains that anchor it to the Golgi membrane, allowing it to facilitate vesicular transport between different Golgi compartments and potentially to other cellular destinations .

How conserved is TVP23 across fungal species?

TVP23 demonstrates remarkable evolutionary conservation across fungal species including Candida albicans, Saccharomyces cerevisiae, Aspergillus species, and many others . This high degree of conservation suggests fundamental roles in cellular function. Sequence alignment studies reveal conserved domains across these species, particularly in the transmembrane regions and in motifs involved in protein-protein interactions . The mammalian homolog, TVP23B, shares significant structural and functional similarities with fungal TVP23, further emphasizing its evolutionary importance .

What are the primary structural characteristics of TVP23?

TVP23 is characterized by multiple transmembrane domains that facilitate its anchoring in the Golgi membrane system . The protein contains functionally important regions that mediate interactions with other Golgi proteins, particularly YIPF6 in mammalian systems, which has been confirmed through co-immunoprecipitation studies . These interaction domains are likely critical for the protein's role in maintaining Golgi structure and function. The specific tertiary structure reveals domains positioned to facilitate vesicular trafficking and interaction with glycosylation enzymes in the Golgi lumen .

What is the primary function of TVP23 in Golgi apparatus physiology?

TVP23 plays a critical role in maintaining Golgi structure and function, particularly in the processes of protein glycosylation and membrane trafficking . Research indicates that TVP23 interacts with glycosylation enzymes and ensures their proper localization within the Golgi compartments. When TVP23 is deficient, there is a notable decrease in several critical glycosylation enzymes, leading to impaired protein processing and secretion . This functional role has been demonstrated through comparative Golgi proteome analyses in TVP23-deficient cells, which revealed significant alterations in protein composition and trafficking pathways .

How does TVP23 contribute to host-microbe interactions?

Based on studies of its mammalian homolog TVP23B, this protein is essential for maintaining the intestinal barrier function through its effects on Paneth cells and goblet cells . TVP23B controls the homeostasis of Paneth cells and the function of goblet cells, leading to the production of antimicrobial peptides and formation of an impenetrable mucus layer, which together create a barrier against microbial invasion . In TVP23B-deficient models, researchers observed a decrease in antimicrobial peptides and a more penetrable mucus layer, resulting in increased susceptibility to bacterial invasion and colitis . This suggests that fungal TVP23 may play analogous roles in maintaining cellular defenses against microbial challenges .

What protein interactions are critical for TVP23 function?

TVP23 engages in critical interactions with other Golgi proteins to fulfill its cellular functions. Particularly significant is its binding with YIPF6, which has been confirmed through co-immunoprecipitation studies using HA-tagged TVP23B and FLAG-tagged YIPF6 . This interaction appears essential for maintaining proper Golgi function and structure. YIPF6 deficiency results in similar cellular phenotypes as TVP23 deficiency, suggesting they function in a common pathway . The TVP23-YIPF6 complex appears to facilitate the retention and proper functioning of glycosylation enzymes within the Golgi apparatus, as proteome analyses of deficient cells show common deficiencies in several critical glycosylation enzymes .

What are the optimal methods for expressing recombinant Candida albicans TVP23?

Recombinant expression of Candida albicans TVP23 can be achieved using several expression systems, with E. coli being commonly employed for initial studies . For functional studies requiring proper protein folding and post-translational modifications, yeast expression systems (particularly S. cerevisiae) provide advantages due to the conserved cellular machinery . The protocol typically involves:

  • Gene synthesis or PCR amplification of the TVP23 coding sequence from Candida albicans genomic DNA

  • Cloning into an appropriate expression vector with a suitable promoter (e.g., GAL1 for inducible expression)

  • Introduction of affinity tags (e.g., His-tag) for purification purposes

  • Transformation into the expression host

  • Induction of protein expression under optimized conditions

  • Cell lysis and membrane protein extraction using detergents

  • Purification via affinity chromatography

For mammalian cell expression, which may be necessary for certain functional studies, viral vector systems can be employed with HEK293 or CHO cells serving as suitable hosts .

What methodologies are most effective for studying TVP23 protein-protein interactions?

Several complementary approaches have proven effective for investigating TVP23 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique has successfully demonstrated the interaction between TVP23B and YIPF6 using HA-tagged TVP23B and FLAG-tagged YIPF6 in transiently co-transfected cells . The protocol involves:

    • Cell lysis in non-denaturing conditions

    • Immunoprecipitation using antibodies against one of the protein tags

    • Western blotting to detect the co-precipitated partner protein

  • Proximity Labeling Techniques: BioID or APEX2-based approaches can identify proximal proteins in the native cellular environment.

  • Yeast Two-Hybrid Screening: Particularly useful for initial discovery of interaction partners.

  • Fluorescence Resonance Energy Transfer (FRET): For studying interactions in living cells.

  • Mass Spectrometry-Based Proteomics: This approach has been used to identify altered Golgi proteomes in TVP23-deficient cells, revealing common deficiencies in several critical glycosylation enzymes .

What are the recommended protocols for analyzing TVP23 knockout phenotypes?

Analysis of TVP23 knockout phenotypes requires a multi-faceted approach:

  • Generation of Knockout Models:

    • CRISPR/Cas9 targeting has been successfully used to generate frameshift alleles of the TVP23B gene

    • Conditional alleles can be created using techniques like Flox/Cre systems for tissue-specific deletion

  • Phenotypic Analysis:

    • Histological examination using appropriate stains (e.g., PAS staining)

    • Immunofluorescent staining for specific markers (e.g., lysozyme for Paneth cells)

    • Ultrastructural analysis via electron microscopy to examine cellular organelles and structures

    • Mass spectrometry to analyze changes in peptide/protein profiles

  • Functional Assays:

    • For intestinal barrier studies: bacterial penetration assays, measuring tissue-associated bacteria via quantitative 16S PCR

    • For glycosylation function: analysis of glycoprotein patterns using lectin binding assays

  • Rescue Experiments:

    • Re-expression of wild-type TVP23 in knockout backgrounds to confirm phenotype specificity

How can TVP23 function be analyzed in the context of pathogen-host interactions?

Analyzing TVP23 function in pathogen-host interactions requires sophisticated experimental approaches:

  • Infection Models:

    • The Citrobacter rodentium model of colitis has been used with TVP23B-deficient mice to study intestinal pathogen responses

    • This model mimics human enteropathogenic Escherichia coli infection and revealed that TVP23B-deficient mice experienced severe weight loss, diarrhea, and failed to clear bacteria

  • Bacterial Burden Analysis:

    • Quantification of pathogen burden in tissues and stool samples using selective culture techniques

    • Measurement of bacterial clearance rates over time

  • Tissue-Associated Microbiome Analysis:

    • 16S sequencing of mucosal-associated bacteria to identify changes in microbial composition

    • Quantitative 16S PCR to measure the number of tissue-associated bacteria

  • Microbial Translocation Studies:

    • Co-staining of bacteria and mucus layers to visualize bacterial penetration

    • Fluorescence in situ hybridization (FISH) to localize specific bacterial populations

  • Immunological Response Assessment:

    • Analysis of inflammatory markers and immune cell infiltration

    • Measurement of antimicrobial peptide production

What are the implications of TVP23 dysfunction for cellular glycosylation processes?

TVP23 dysfunction has significant implications for cellular glycosylation processes:

Aspect of GlycosylationImpact of TVP23 DysfunctionDetection Method
Glycosylation Enzyme LocalizationMislocalization of critical enzymesImmunofluorescence microscopy
Golgi StructureAltered morphology and compartmentalizationElectron microscopy
Glycoprotein ProcessingIncomplete or aberrant glycan structuresMass spectrometry glycomics
Secreted GlycoproteinsChanges in glycosylation patternsLectin blotting, glycan analysis
Membrane Glycoprotein PresentationAltered cell surface glycan profileFlow cytometry with lectins

Research has shown that TVP23-deficient cells exhibit a common deficiency of several critical glycosylation enzymes in the Golgi proteome . This results in compromised mucin glycosylation, leading to a more penetrable mucus layer in intestinal models . The specific glycosylation defects can be characterized through comparative glycomics approaches using mass spectrometry to identify changes in glycan structures on specific proteins.

How does TVP23 contribute to maintaining cellular homeostasis during stress conditions?

TVP23 appears to play a crucial role in cellular adaptation to stress conditions:

  • Response to Inflammatory Stress:

    • TVP23B knockout mice show increased susceptibility to DSS-induced colitis, suggesting its importance in inflammatory stress response

    • The protein helps maintain epithelial barrier integrity during inflammatory challenges

  • Pathogen-Induced Stress:

    • TVP23 contributes to antimicrobial defense mechanisms through its effects on secretory pathways

    • It regulates the production and secretion of antimicrobial peptides, particularly alpha-defensins

  • Oxidative Stress:

    • The protein may help maintain Golgi function during oxidative stress conditions

    • Its role in proper protein glycosylation could affect cellular resilience to stress

  • ER Stress and Unfolded Protein Response:

    • As a Golgi protein involved in trafficking, TVP23 likely influences how cells handle increased protein loads during stress

These stress-responsive functions can be studied using various cellular stress models combined with molecular and cellular analyses of TVP23-deficient versus wild-type cells.

What are common challenges in purifying recombinant TVP23 and how can they be addressed?

Purification of recombinant TVP23 presents several challenges due to its nature as a transmembrane protein:

  • Low Expression Levels:

    • Challenge: Transmembrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion partners that enhance expression (e.g., MBP, SUMO)

  • Protein Solubility:

    • Challenge: Membrane proteins tend to aggregate during extraction

    • Solution: Screen multiple detergents (e.g., DDM, CHAPS, Triton X-100) for optimal solubilization; consider using amphipols or nanodiscs for maintaining native-like environment

  • Protein Stability:

    • Challenge: TVP23 may be unstable once removed from the membrane environment

    • Solution: Add stabilizing agents (glycerol, specific lipids), optimize buffer conditions, and handle at 4°C throughout purification

  • Purification Yield:

    • Challenge: Low yields due to multiple purification steps

    • Solution: Minimize purification steps, optimize each step for recovery, consider on-column folding techniques

  • Functional Verification:

    • Challenge: Confirming that purified protein retains native activity

    • Solution: Develop in vitro functional assays, such as reconstitution into liposomes followed by binding studies with known interaction partners like YIPF6

How can researchers address contradictory data in TVP23 functional studies?

When faced with contradictory data in TVP23 research, consider these methodological approaches:

  • Standardize Experimental Conditions:

    • Ensure consistent cell types, expression systems, and assay conditions across studies

    • Document detailed protocols to enhance reproducibility

  • Verify Protein Expression and Localization:

    • Confirm proper expression levels and correct subcellular localization of TVP23

    • Use multiple detection methods (Western blot, immunofluorescence) with different antibodies

  • Control for Compensatory Mechanisms:

    • Investigate potential upregulation of related proteins (e.g., TVP23 homologs) that might mask phenotypes

    • Consider using acute knockdown in addition to stable knockout models

  • Cross-Validate with Multiple Approaches:

    • Use complementary techniques to verify key findings

    • Combine genetic, biochemical, and cell biological approaches

  • Consider Context-Dependent Functions:

    • TVP23 may have different roles in different cell types or organisms

    • Explicitly test for cell-type specificity or species-specific functions

For example, studies in mice have specifically shown that intestinal epithelial-specific deletion of TVP23B using Villin-Cre confirms the protein's role in preventing colitis, ruling out potential confounding effects from other cell types .

What considerations are important when interpreting phenotypic data from TVP23 mutant studies?

When interpreting phenotypic data from TVP23 mutant studies, researchers should consider:

  • Genetic Background Effects:

    • The genetic background can significantly influence phenotypic manifestations

    • Use appropriate controls matched for genetic background, and consider testing on multiple backgrounds

  • Developmental Compensation:

    • Chronic gene deletion may trigger compensatory mechanisms

    • Compare acute (e.g., inducible) versus constitutive knockout phenotypes

  • Cell-Type Specific Effects:

    • TVP23 may have different functions in different cell types

    • Use conditional knockouts to target specific cell populations, as demonstrated with Villin-Cre for intestinal epithelial cells

  • Primary versus Secondary Effects:

    • Distinguish direct consequences of TVP23 loss from downstream secondary effects

    • Use time-course studies and rescue experiments to clarify causal relationships

  • Molecular Mechanisms Underlying Phenotypes:

    • Connect phenotypic observations to specific molecular defects

    • For example, TVP23B deficiency leads to decreased antimicrobial peptides and altered mucus, which then results in increased bacterial penetration and inflammation

  • Environmental Influences:

    • Microbiome composition may influence phenotypic outcomes in TVP23 mutants

    • Control for and document environmental conditions that might affect results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.