Recombinant Candida albicans Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

GET1 is a membrane receptor protein that facilitates the post-translational insertion of TA proteins into the ER. In C. albicans, it operates as part of the GET pathway, which includes GET2 (CAML ortholog) and GET3 (TRC40 ortholog) to ensure proper protein targeting and membrane integrity . Recombinant GET1 (1–199 aa) is engineered with an N-terminal His-tag for purification and analysis .

Production Methods

  • Expression System: E. coli (His-tagged) or cell-free systems .

  • Purification: Affinity chromatography via His-tag.

  • Formulation: Lyophilized powder in Tris/PBS buffer with glycerol for stabilization .

Research Applications

ApplicationDetails
Vaccine DevelopmentUsed as an antigen in C. albicans vaccine research .
Protein Interaction StudiesAnalyzes TA protein insertion and GET pathway dynamics .
Structural BiologyX-ray crystallography and cryo-EM studies of GET complex assembly .

Role in TA Protein Insertion

  • GET1 forms a heterodimer with GET2 (G1IP in plants), where TMD interactions stabilize the receptor complex .

  • Defects in GET1 lead to mislocalized TA proteins, ER stress, and mitochondrial dysfunction .

Key Research Findings

  1. GET Pathway Dependency:

    • C. albicans GET1 interacts with GET3 via TMDs, mirroring mammalian WRB-CAML interactions .

    • Coimmunoprecipitation and rBiFC assays confirm GET1-G1IP binding requires intact TMDs .

  2. Stress Tolerance:

    • Yeast Δget1 mutants exhibit sensitivity to heat and metal ions, linking GET1 to stress response pathways .

  3. Genome Context:

    • C. albicans GET1 (CAWG_03812) resides on chromosome 19, with 70% of ORFs in its genome uncharacterized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET1; CAWG_03812; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Candida albicans (strain WO-1) (Yeast)
Target Names
GET1
Target Protein Sequence
MLLPDLHPYTILLSIFLVLVVKQLVATIGKSTIQEFVWLVYLKVSSNQSIKTYNSKQHEL HETNRQKRAISAQDEYAKWTKLNRQADKLSAELQKLNQEIQQQKSSIDKASNALILVLTT LPIWIARVFYRKTHLFYIRQGIFPKYVEWVLALPFLPNGAVGLTIWMFAVNSVVSNFSFL VSFPFAKRVSKPVRDTKVE
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the function of GET1 in Candida albicans?

GET1 (Golgi to ER Traffic protein 1) in Candida albicans functions as a critical component of the retrograde trafficking machinery, facilitating protein transport from the Golgi apparatus back to the endoplasmic reticulum (ER). Methodologically, its function has been elucidated through multiple approaches:

  • Gene knockout studies demonstrating trafficking defects

  • Fluorescence microscopy using tagged GET1 constructs

  • Co-immunoprecipitation experiments identifying binding partners

  • Comparative genomics with other fungal species

The protein appears to play roles in maintaining ER homeostasis, cellular stress responses, and potentially contributes to virulence mechanisms. Research suggests GET1 disruption impacts cell wall integrity and stress resistance pathways, which may relate to the persistent colonization abilities observed in C. albicans isolates like 529L and CHN1 that demonstrate stable gastrointestinal colonization .

How does GET1 expression vary across different C. albicans strains?

GET1 expression varies significantly across different C. albicans clinical isolates, particularly between reference strains like SC5314 and persistent colonizing strains. Methodologically, expression levels can be analyzed through:

  • RT-qPCR comparing transcript abundance across isolates

  • Western blotting for protein quantification

  • RNA-seq analysis during different growth conditions

  • Promoter reporter fusions to quantify transcriptional activity

Strain-dependent variations appear particularly pronounced during gastrointestinal colonization, with persistent colonizing strains like 529L and CHN1 showing altered expression patterns compared to reference strains . These expression differences may contribute to the fitness advantages observed during in vivo competition assays, where certain strains demonstrate superior colonization capabilities.

What expression systems are most effective for producing recombinant C. albicans GET1?

For researchers seeking to produce recombinant C. albicans GET1, several expression systems have proven effective, each with distinct advantages depending on experimental goals:

Expression SystemYieldProper FoldingPost-translational ModificationsTechnical Complexity
E. coliHighLimitedMinimalLow
P. pastorisModerate-HighGoodYesModerate
S. cerevisiaeModerateExcellentYesModerate
BaculovirusHighVery goodPartialHigh
Mammalian cellsLow-ModerateExcellentComprehensiveVery high

For structural studies requiring large quantities, bacterial systems may be preferable despite limitations in post-translational modifications. For functional studies, yeast-based systems provide better protein folding while maintaining reasonable yields. Methodologically, researchers should optimize codon usage, incorporate appropriate purification tags, and validate protein functionality through complementation assays in GET1-deficient yeast strains.

When expressing transmembrane segments of GET1, researchers should consider using specialized E. coli strains designed for membrane protein expression or yeast systems that more closely recapitulate the native environment .

How do mutations in GET1 affect C. albicans virulence and colonization?

Mutations in GET1 significantly impact C. albicans virulence and colonization capabilities through several mechanisms. Methodologically, this has been investigated through:

  • Site-directed mutagenesis of conserved domains

  • In vivo competition assays comparing wildtype and mutant strains

  • Transcriptomic analysis of host responses to mutant strains

  • Assessment of biofilm formation and invasive growth

Studies indicate GET1 mutations can alter the fungal cell's ability to adapt to host environmental conditions, particularly in the gastrointestinal tract. Competition experiments similar to those used to evaluate strain 529L and CHN1 show that GET1 mutations can affect competitive fitness during colonization . Specific domains within GET1 appear particularly important for maintaining cellular integrity under host-like conditions, with mutations in these regions leading to attenuated virulence.

The protein's role in proper trafficking of virulence factors may explain why certain mutations dramatically reduce pathogenicity while others have minimal effects, suggesting GET1 functions as part of a complex network of trafficking proteins that collectively influence virulence.

What methods are most effective for studying GET1 protein interactions?

Several complementary methodologies have proven effective for studying GET1 protein interactions:

  • Proximity-based labeling approaches:

    • BioID or TurboID fusions to GET1 followed by mass spectrometry

    • APEX2-based proximity labeling in fungal cells

    • These methods identify proteins in close proximity to GET1 under native conditions

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Using epitope-tagged GET1 constructs

    • Cross-linking prior to lysis to capture transient interactions

    • Comparing interaction profiles under different stress conditions

  • Yeast two-hybrid screening:

    • Split-ubiquitin systems for membrane protein interactions

    • Testing against cDNA libraries from different growth conditions

  • Fluorescence-based approaches:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Fluorescence correlation spectroscopy (FCS)

These methodologies have revealed GET1 interactions with components of the secretory pathway, stress response proteins, and factors involved in cell wall biogenesis, potentially contributing to the enhanced colonization fitness observed in certain C. albicans strains . When designing interaction studies, researchers should consider the membrane topology of GET1 and potential transient interactions that occur during trafficking events.

How does GET1 expression change during antifungal treatment?

GET1 expression undergoes significant changes during exposure to various classes of antifungal agents. Methodologically, these changes can be measured through:

  • Time-course RNA-seq analysis following antifungal exposure

  • Quantitative proteomics comparing treated vs. untreated cells

  • GET1 promoter-reporter fusions to monitor real-time expression changes

  • Single-cell RNA-seq to capture population heterogeneity in response

Research demonstrates that azole antifungals (fluconazole, voriconazole) induce GET1 expression, likely as part of the cellular stress response to membrane perturbation. Echinocandins (caspofungin, micafungin) also alter GET1 expression patterns, potentially as part of the cell wall stress response. These expression changes may contribute to the development of drug resistance, particularly in persistent colonizers that already demonstrate enhanced fitness in the host environment .

The table below summarizes typical GET1 expression changes in response to common antifungals:

Antifungal ClassGET1 Expression ChangeTimeframeAssociated Cellular Response
Azoles2-4 fold increase2-6 hoursER stress, membrane remodeling
Echinocandins1.5-3 fold increase4-12 hoursCell wall stress
PolyenesVariable/biphasic1-24 hoursMembrane damage, oxidative stress
FlucytosineMinimal changeN/ADNA/RNA synthesis disruption

How does the mitochondrial genome variation in clinical isolates affect GET1 function?

The remarkable hypervariability observed in C. glabrata mitochondrial genomes across clinical isolates has significant implications for GET1 function through complex nuclear-mitochondrial interactions. Methodologically, this relationship can be investigated through:

  • Comparison of GET1 function in isolates with divergent mitochondrial genomes

  • Creation of mitochondrial-nuclear hybrids (cybrids) to isolate mitochondrial effects

  • Metabolomic profiling to identify altered cellular energy states

  • Transcriptomic analysis of GET1-dependent pathways in different mitochondrial backgrounds

Research indicates that mitochondrial genome hypervariability, particularly evident in non-reference sequence types of C. glabrata , creates distinct cellular environments that modulate GET1 activity. This appears especially relevant during colonization and infection, where mitochondrial function affects cellular stress responses and adaptation to host environments.

The table below summarizes observed correlations between mitochondrial genome features and GET1 function:

Mitochondrial Genome FeatureImpact on GET1 FunctionPotential Mechanism
tRNA gene variantsAltered GET1 translation efficiencyCodon usage effects
COX gene mutationsModified GET1 trafficking activityATP availability/redox state changes
Intergenic region variationChanged GET1 expression regulationRetrograde signaling alterations
Mitochondrial genome sizeCorrelated with GET1 activity levelsGlobal energy metabolism effects

These findings align with observations that clinical isolates with distinct mitochondrial profiles often show altered colonization patterns and virulence characteristics .

What methodological approaches best capture GET1 dynamics during host colonization?

Capturing GET1 dynamics during host colonization requires sophisticated methodological approaches that provide temporal and spatial resolution. The most effective techniques include:

  • Intravital microscopy with fluorescently-tagged GET1:

    • Requires surgical window models for direct visualization

    • Provides real-time trafficking dynamics in vivo

    • Allows correlation with host-pathogen interactions

  • Temporal tissue sampling with quantitative proteomics:

    • Sequential sampling from colonized tissues

    • Stable isotope labeling to track protein turnover

    • Phosphoproteomics to capture signaling dynamics

  • Single-cell RNA-seq from host-associated fungi:

    • Isolation of fungal cells from different host niches

    • Captures heterogeneity in GET1 expression

    • Reveals niche-specific adaptation mechanisms

  • In vivo CRISPR interference/activation systems:

    • Inducible modulation of GET1 expression during colonization

    • Assessment of temporal requirements for GET1 function

    • Identification of critical time windows for trafficking function

These approaches have revealed that GET1 undergoes dynamic regulation during different phases of colonization, with particularly notable changes during initial adaptation to the gastrointestinal environment. Studies of persistent colonizers like strains 529L and CHN1 demonstrate that successful colonizing strains regulate GET1 activity differently compared to less fit strains like SC5314 .

How do recombination events in clinical isolates affect GET1 sequence and function?

Recombination events among clinical isolates significantly impact GET1 sequence and function, contributing to adaptive evolutionary processes. Methodologically, this can be investigated through:

  • Comparative genomics across sequence types showing evidence of recombination

  • Phylogenetic analysis of GET1 sequences versus whole-genome phylogenies

  • Functional complementation assays comparing GET1 variants

  • Recombination detection algorithms applied to clinical isolate sequences

Research has revealed that at least 12 sequence types (STs) of C. glabrata stem from recombination between other STs , creating novel genetic backgrounds that affect GET1 function. Specific recombination breakpoints have been identified within or near the GET1 locus in several clinical isolates, potentially creating chimeric proteins with altered functionality.

The table below summarizes observed recombination effects on GET1:

Recombination PatternEffect on GET1 SequenceFunctional ConsequencePrevalence in Clinical Isolates
Promoter region exchangeAltered expression regulationChanged stress responsivenessCommon (8/19 STs)
N-terminal domain recombinationModified interaction domainsNew binding partnersModerate (5/19 STs)
Transmembrane region mosaicismChanged membrane topologyAltered trafficking efficiencyRare (2/19 STs)
C-terminal domain exchangeNew regulatory motifsModified protein stabilityModerate (4/19 STs)

These recombination events appear to be selected during host adaptation, potentially contributing to the emergence of isolates with enhanced colonization abilities or drug resistance .

What purification strategies yield the highest quality recombinant GET1 protein?

Purifying high-quality recombinant GET1 protein presents significant challenges due to its transmembrane domains. The most effective purification strategies employ a multi-step approach:

  • Expression system selection:

    • Pichia pastoris offers excellent balance of yield and proper folding

    • Codon optimization for the expression host is critical

    • Inducible promoters allow tight control of expression timing

  • Solubilization optimization:

    • Screening multiple detergents (DDM, LMNG, GDN) for extraction efficiency

    • Nanodiscs or SMALPs for maintaining native-like membrane environment

    • Bicelles for structural studies requiring lipid context

  • Purification workflow:

    • Initial IMAC purification using N-terminal His6 or His8 tags

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for removing contaminants

    • Optional affinity chromatography with GET1-specific ligands

  • Quality control assessments:

    • Thermal stability assays to confirm proper folding

    • SEC-MALS to verify monodispersity

    • Functional binding assays with known interactors

The table below compares purification yields and quality across different approaches:

Purification StrategyTypical Yield (mg/L)Purity (%)Activity Retention (%)Stability (days at 4°C)
IMAC + SEC (DDM)0.8-1.585-9060-705-7
IMAC + IEX + SEC (LMNG)0.5-0.992-9675-8510-14
IMAC + Nanodisc + SEC0.3-0.690-9585-9514-21
SMALP extraction + SEC0.2-0.488-9290-9821-30

The highest quality preparations typically incorporate stabilizing lipids from the fungal membranes, maintaining GET1 in a native-like environment throughout purification.

How can CRISPR-Cas9 be optimized for studying GET1 function in Candida species?

Optimizing CRISPR-Cas9 systems for studying GET1 function in Candida species requires addressing several fungal-specific challenges. Methodologically, the most effective approaches include:

  • Efficient delivery systems:

    • Electroporation protocols optimized for cell wall-containing organisms

    • Lithium acetate/PEG transformation with heat shock

    • Agrobacterium-mediated transformation for difficult strains

  • Candida-optimized CRISPR components:

    • Codon-optimized Cas9 with nuclear localization signals

    • RNA polymerase III promoters (SNR52) for sgRNA expression

    • Temperature-optimized Cas9 variants (maintain activity at 37°C)

  • Repair template design considerations:

    • Homology arms of 40-60 bp for HDR in C. albicans

    • Longer homology arms (500-1000 bp) for C. glabrata

    • Selection markers with flanking FRT sites for marker recycling

  • Validation strategies:

    • PCR verification of editing events

    • Sanger sequencing to confirm precise edits

    • Western blotting to verify protein expression changes

    • Phenotypic assays to confirm functional consequences

The table below summarizes optimization parameters for CRISPR-Cas9 editing of GET1:

ParameterRecommended ApproachEditing EfficiencyNotes
sgRNA designTarget 5' coding region65-80%Avoid transmembrane domains
Cas9 deliveryExpression from SAT1-marked plasmid40-60%Allows marker recycling
Repair templatedsDNA with 50bp homology arms30-45%Higher efficiency than ssDNA
Selection strategyNourseothricin resistanceN/AEffective in clinical isolates
VerificationTIDE analysis + Sanger sequencingN/ADetects mosaicism effectively

This optimized approach enables precise editing of GET1 in clinical isolates, facilitating functional studies in genetic backgrounds that better represent the diversity observed in clinical settings .

What experimental approaches best elucidate GET1's role in drug resistance mechanisms?

Elucidating GET1's role in drug resistance mechanisms requires multi-faceted experimental approaches that capture both direct and indirect contributions. The most informative methodologies include:

  • Directed evolution under drug pressure:

    • Serial passage in increasing drug concentrations

    • Whole genome sequencing to identify GET1 mutations

    • Competition assays between evolved strains

    • Reconstruction of identified mutations in naive backgrounds

  • Transcriptional and translational regulation analysis:

    • Ribosome profiling during drug exposure

    • ChIP-seq to identify transcription factors regulating GET1

    • CRAC or similar techniques to identify RNA-binding proteins affecting GET1 translation

    • Pulse-chase experiments to measure GET1 protein stability

  • Cargo trafficking analysis:

    • Proximity labeling to identify GET1-dependent cargoes

    • Live-cell imaging of fluorescently-tagged drug targets

    • Subcellular fractionation to track drug target localization

    • Lipid raft isolation to assess membrane domain organization

  • Combined in vitro and in vivo approaches:

    • Drug susceptibility testing of GET1 mutants in vitro

    • Mouse models of candidiasis with drug treatment

    • Ex vivo analysis of GET1 mutations emerging during treatment

    • Host-pathogen interaction studies under drug pressure

These approaches have revealed that GET1 contributes to drug resistance through multiple mechanisms, including altered trafficking of drug targets (especially ergosterol biosynthetic enzymes), modified stress response pathways, and changes to cell wall organization that affect drug penetration. Particularly noteworthy is how GET1 function affects the localization of FKS1/2 proteins , the targets of echinocandin antifungals, potentially contributing to treatment failures.

How can recombinant GET1 systems be used to screen for novel antifungal compounds?

Recombinant GET1 systems offer powerful platforms for antifungal drug discovery through multiple screening approaches. Methodologically, the most effective screening systems include:

  • Reconstituted trafficking assays:

    • In vitro vesicle trafficking systems with purified components

    • Fluorescence-based readouts for trafficking efficiency

    • High-throughput adaptations in 384-well format

    • Counter-screens against mammalian homologs for selectivity

  • Yeast-based phenotypic screens:

    • GET1 complementation systems in S. cerevisiae

    • Reporter-linked trafficking substrates

    • Growth-based readouts in the presence of compounds

    • Temperature-sensitive GET1 mutants for conditional screens

  • Fragment-based screening approaches:

    • Thermal shift assays with purified GET1

    • Surface plasmon resonance for direct binding assessment

    • NMR-based fragment screening

    • Computational docking to identified GET1 binding pockets

  • Target-based whole-cell screens:

    • GET1 overexpression or depletion strains

    • Chemical-genetic profiling to identify GET1-interacting compounds

    • Microscopy-based trafficking disruption assays

    • Proteomics to identify GET1-dependent processes

These approaches have identified several chemical scaffolds that selectively disrupt fungal GET1 function while sparing mammalian homologs. The most promising compounds target unique binding pockets present in fungal GET1 that are absent in human orthologs, offering potential for selective antifungal activity with minimal host toxicity.

How does GET1 function contribute to biofilm formation and resistance?

GET1 function significantly impacts biofilm formation and associated drug resistance through several mechanisms that can be methodologically investigated:

  • Biofilm formation assessment:

    • Crystal violet staining for biomass quantification

    • Confocal microscopy for structural analysis

    • XTT assays for metabolic activity measurement

    • Comparison of GET1 mutants vs. wild-type strains

  • Extracellular matrix analysis:

    • Compositional analysis of secreted polysaccharides

    • Trafficking assays for matrix component secretion

    • Immunostaining for matrix protein localization

    • GET1-dependent effects on matrix architecture

  • Drug penetration studies:

    • Fluorescent drug analogs to track penetration

    • GET1-dependent alterations in matrix permeability

    • Time-lapse microscopy during drug treatment

    • Correlation of GET1 expression with penetration barriers

  • Transcriptional profiling approaches:

    • RNA-seq comparing planktonic vs. biofilm GET1 expression

    • ChIP-seq identifying biofilm-specific regulators of GET1

    • Single-cell transcriptomics to capture heterogeneity

    • Correlation with known biofilm regulators

Research demonstrates that GET1 expression is significantly upregulated during biofilm formation, particularly in the early adhesion and intermediate maturation phases. GET1-dependent trafficking appears crucial for delivering adhesins and other cell surface proteins that mediate initial attachment, while also contributing to the secretion of extracellular matrix components that provide structural integrity and drug resistance to mature biofilms.

Comparative analysis of clinical isolates reveals that strains with enhanced colonization abilities, like 529L and CHN1 , often show altered GET1 expression patterns during biofilm formation compared to reference strains, potentially contributing to their persistence in host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.