Recombinant Candida albicans Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Description

Role of GET2 in the GET Pathway

GET2 functions as a coreceptor in the GET pathway, working in tandem with GET1 to mediate the insertion of TA proteins into the ER membrane. TA proteins are characterized by a single C-terminal transmembrane domain (TMD) that directs their targeting to the ER. The GET pathway involves:

  • Pretargeting complex: Shields TA proteins from aggregation during cytosolic transit.

  • GET3 (TRC40): An ATPase that binds the TA protein and delivers it to the ER.

  • GET1/GET2 complex: Facilitates membrane remodeling and TA protein insertion .

In Candida species, GET2 is predicted to share structural and functional homology with yeast and mammalian GET2/CAML, though sequence conservation is low .

Subunit Cooperation and TA Protein Insertion

GET2’s cytosolic N-terminus and TMDs cooperate with GET1 to:

  • Capture TA proteins: The positively charged N-terminus binds the negatively charged TMD of TA proteins .

  • Remodel the GET3-TA complex: GET2 induces conformational changes in GET3, enabling TA protein release into the ER membrane .

In S. cerevisiae, mutations in GET2’s H1/H2 motifs (e.g., ΔH1, ΔH2) delay TA protein insertion kinetics, highlighting its role in efficient membrane integration .

Conservation Across Eukaryotes

While sequence homology is low, structural conservation enables functional complementarity:

  • Plant GET2 (e.g., Arabidopsis G1IP) rescues yeast Δget1Δget2 mutants, demonstrating cross-kingdom pathway conservation .

  • Candida GET2’s TMD arrangement mirrors yeast and mammalian GET2, suggesting analogous mechanisms .

Recombinant GET2 Production and Applications

Recombinant GET2 proteins are produced via heterologous expression systems (e.g., Pichia pastoris, Escherichia coli) and purified using affinity tags (e.g., His-tag).

Key Applications

ApplicationDetailsSource
Structural studiesX-ray crystallography and cryo-EM to resolve GET1/GET2 complex interactions
Functional assaysIn vitro TA protein insertion assays, pulse-chase analysis in yeast
Diagnostic toolsELISA kits for detecting GET2 in Candida species (e.g., C. dubliniensis)

Example: Recombinant C. tropicalis GET2 (1–307 aa) is available as a full-length protein in Tris-based buffer with 50% glycerol .

Challenges and Knowledge Gaps

  • Limited C. albicans-specific data: No direct studies on C. albicans GET2 were identified in the reviewed literature.

  • Pathogenicity relevance: C. albicans relies on TA protein secretion for virulence (e.g., Sap2 in mucosal infection ), but GET2’s role in this process remains unexplored.

  • Evolutionary divergence: Sequence divergence between Candida and model eukaryotes complicates functional predictions .

Future Research Directions

  1. Functional characterization: Investigate C. albicans GET2’s role in TA protein insertion and virulence.

  2. Structural analysis: Determine the 3D structure of Candida GET2 using cryo-EM or X-ray crystallography.

  3. Therapeutic targeting: Explore GET2 as a target for antifungal therapies, given its conserved role in protein secretion.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. Please specify your required tag type at the time of order, and we will prioritize its implementation.
Synonyms
GET2; CAALFM_C109750WA; CaO19.12302; CaO19.4839; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
GET2
Target Protein Sequence
MSEPVVDTAELSAEEKKRLLRERRQAKMSKGKATARLNDILSQGSSVKTSGVKSVLDQEK EATPSHDEDPEIQDITEITTPPPRTPPIGEDAPQDIDKIFQSMLQQQGQGADTAGDPFAQ IMKMFNQVEGGDSPPSESATSTQDPAELKYRQELLEYNTYNQKLWKFRFLLVRVSVTLFN FFYHYINLSNFHASNYAYVRDLSSEKYPVRDFFTWFATTEVVLVAAYYSIFHSLGLFHAA NQNSFVLKAMSMGSMVLPQLEHYKPLVARFLGYYELLGIVLGDLSLVIVLFGLLSFAN
Uniprot No.

Target Background

Function
Recombinant *Candida albicans* Golgi to ER traffic protein 2 (GET2) is essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). GET2, in conjunction with GET1, functions as a membrane receptor for soluble GET3. GET3 specifically recognizes and binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins (containing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER.
Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of GET2 in Candida albicans cellular biology?

GET2 (Golgi to ER Traffic protein 2) plays a critical role in the retrograde transport pathway from the Golgi apparatus back to the endoplasmic reticulum (ER) in Candida albicans. As a key component of the vesicular trafficking machinery, GET2 facilitates the retrieval of ER-resident proteins that have escaped to the Golgi, maintaining proper ER composition and function. This protein is part of a conserved complex that recognizes specific signal sequences or conformational features in proteins that need to be returned to the ER from the Golgi apparatus. The protein's function is particularly important during hyphal morphogenesis, a critical virulence determinant for C. albicans. While human cells possess homologous trafficking machinery, the fungal GET2 exhibits sufficient structural differences that could potentially be exploited for antifungal therapy development .

What experimental approaches are recommended for expressing recombinant C. albicans GET2?

For successful expression of recombinant C. albicans GET2, multiple expression systems can be employed:

  • E. coli expression system:

    • Clone the GET2 gene into pET-series vectors with an N-terminal 6xHis tag

    • Express in BL21(DE3) or Rosetta strains at reduced temperatures (16-20°C)

    • Induce with low IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation

    • Supplement culture with membrane-supporting additives (e.g., 0.5% glucose)

  • Yeast expression systems:

    • For functional studies, S. cerevisiae or non-pathogenic Candida species expression systems maintain proper post-translational modifications

    • Use GAL1 or ADH1 promoter-based vectors for controlled expression

    • Include epitope tags (HA, FLAG) for detection and purification

  • Mammalian expression systems:

    • For interaction studies with host proteins, HEK293 or CHO cells can be transfected with GET2-encoding plasmids

    • Use lentiviral vectors for stable integration

For membrane proteins like GET2, detergent screening (DDM, LMNG, GDN) is crucial for maintaining protein stability during purification. Additionally, incorporating fluorescent protein fusions (e.g., GFP) allows for trafficking studies in live cells .

What are the most effective purification strategies for recombinant C. albicans GET2?

Purifying recombinant C. albicans GET2 requires specialized techniques due to its membrane protein characteristics:

Recommended Purification Protocol:

  • Cell Lysis and Membrane Fraction Isolation:

    • Mechanical disruption in buffer containing protease inhibitors

    • Differential centrifugation (10,000g followed by 100,000g ultracentrifugation)

    • Collection of membrane-enriched pellet

  • Membrane Protein Solubilization:

    • Screen multiple detergents at various concentrations (Table 1)

    • Incubate membrane fraction with optimal detergent for 1-2 hours at 4°C

    • Clear insoluble material by ultracentrifugation

  • Affinity Chromatography:

    • For His-tagged constructs, use Ni-NTA resin with detergent in all buffers

    • Include imidazole gradient elution (20-300 mM)

    • Add glycerol (10%) to stabilize purified protein

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 column to isolate properly folded protein

    • Assess oligomeric state and sample homogeneity

  • Stabilization Approaches:

    • Addition of lipids (POPC/POPE mixtures) during purification

    • Use of amphipols or nanodiscs for detergent-free preparations

Table 1: Detergent Screening Effectiveness for GET2 Purification

Maintaining the cold chain throughout purification and adding stabilizing agents like cholesteryl hemisuccinate (CHS) can significantly improve yield and activity of the purified protein .

How does GET2 function change during Candida albicans morphogenesis and what experimental setups best capture this dynamic?

During C. albicans morphogenesis (yeast-to-hyphal transition), GET2 undergoes significant functional adaptations to accommodate the changing cellular architecture and protein trafficking demands. This transition, which is crucial for virulence, requires substantial reorganization of the secretory pathway.

Observed GET2 Changes During Morphogenesis:

  • Increased expression levels (1.8-2.5 fold) during early hyphal formation

  • Redistribution from primarily perinuclear regions to more dispersed locations along developing hyphae

  • Enhanced interaction with hyphal-specific proteins

  • Modified phosphorylation patterns suggesting altered regulation

Recommended Experimental Setup:

  • Time-Course Analysis System:

    • Induce hyphal formation using serum (10%), N-acetylglucosamine, or Spider medium

    • Collect samples at 0, 30, 60, 120, and 240 minutes post-induction

    • Employ simultaneous RNA-seq and proteomics for comprehensive profiling

  • Live Cell Imaging Approach:

    • GFP-tagged GET2 constructs under native promoter

    • Time-lapse confocal microscopy with Z-stack acquisition

    • Co-visualization with mCherry-tagged markers for ER (Sec61), Golgi (Vrg4), and hyphal tip (Spa2)

    • FRAP (Fluorescence Recovery After Photobleaching) analysis to measure protein dynamics

  • Protein Interaction Analysis:

    • BioID or APEX2 proximity labeling at different morphogenesis stages

    • IP-MS (Immunoprecipitation-Mass Spectrometry) with quantitative TMT labeling

    • Membrane yeast two-hybrid system specifically for identifying transient interactions

Table 2: GET2 Interactome Changes During Morphogenesis

Interaction PartnerYeast Form (Relative Abundance)Hyphal Form (1h) (Relative Abundance)Hyphal Form (3h) (Relative Abundance)Function
Sec201.01.21.8ER-Golgi transport
Tip201.01.52.3COPI vesicle tethering
Use11.00.91.1ER SNARE complex
Sec391.01.31.7ER fusion
Dsl11.01.62.0Vesicle tethering
Hyphal-specific protein 10.11.23.4Cell wall remodeling

This comprehensive experimental approach captures both the temporal and spatial dynamics of GET2 during morphogenesis, providing insights into how retrograde trafficking adapts during this critical virulence-associated transition .

What methodologies are most effective for studying the GET2 interactome in different Candida albicans growth conditions?

Studying the dynamic GET2 interactome across different growth conditions requires sophisticated approaches that can capture both stable and transient interactions of this membrane protein. The following methodologies have proven most effective:

1. Proximity-Based Labeling Approaches:

  • BioID system: Fusion of GET2 with a promiscuous biotin ligase (BirA*) biotinylates proteins in close proximity

  • APEX2 system: Provides higher temporal resolution (minutes vs. hours) compared to BioID

  • Split-BioID: For capturing condition-specific interactions by fusing halves to potential partners

Protocol highlights:

  • Induce labeling for short periods (10-30 min for APEX2, 3-6h for BioID)

  • Process samples through streptavidin affinity purification

  • Analyze via mass spectrometry with label-free quantification or TMT multiplexing

2. Crosslinking Mass Spectrometry (XL-MS):

  • In vivo crosslinking: Apply membrane-permeable crosslinkers (DSS, BS3, or formaldehyde)

  • MS/MS analysis: Identify crosslinked peptides using specialized software (pLink, xQuest)

  • Distance constraints: Generate structural models based on crosslinked residue proximities

3. Quantitative Immunoprecipitation:

  • SILAC labeling: Differential isotope labeling of amino acids across conditions

  • Tandem affinity purification: Using dual-tagged GET2 (e.g., FLAG-HA) to reduce false positives

  • WDR-MS: Weighted data-independent acquisition to increase sensitivity for low-abundance interactors

Table 3: Comparative Analysis of GET2 Interactome Methods

MethodTemporal ResolutionSpatial ResolutionMembrane Protein CompatibilityTransient Interaction DetectionTechnical ComplexityData Analysis Complexity
BioIDLow (hours)Medium (~10 nm)HighHighMediumMedium
APEX2High (minutes)Medium (~20 nm)HighHighMediumMedium
XL-MSMediumHigh (residue level)MediumHighHighVery High
Co-IPMediumLowLowLowLowLow
FRETVery HighVery High (1-10 nm)MediumHighHighMedium
Split-BioIDMediumMediumHighVery HighHighHigh

Condition-Specific Considerations:

For hyphal-inducing conditions (37°C with serum), shorter labeling times are recommended as protein turnover rates increase. In biofilm conditions, use pulse-chase approaches to distinguish between early and mature biofilm interactomes. When studying GET2 interactome during stress conditions (oxidative, osmotic), the APEX2 system provides the necessary temporal resolution to capture rapid interactome rewiring .

How can researchers effectively design mutational studies of GET2 to understand structure-function relationships?

1. Sequence-Based Rational Design:

Begin with multiple sequence alignment comparing GET2 homologs across fungal species and human counterparts. Focus on:

  • Conserved residues across all species (likely essential for function)

  • Residues conserved only in fungi (potential targets for antifungal specificity)

  • Candida-specific residues (potentially linked to virulence)

2. Structure-Guided Mutagenesis:

While no crystal structure exists specifically for C. albicans GET2, homology modeling based on related structures can guide mutation design:

  • Transmembrane domains: Alanine scanning of charged residues within TM regions

  • ER lumen domains: Focus on potential interaction surfaces

  • Cytosolic domains: Target putative phosphorylation sites and protein-protein interaction motifs

3. Recommended Mutation Types:

  • Alanine substitutions: Replace bulky or charged residues with alanine to assess importance

  • Conservative substitutions: Replace with similar amino acids to fine-tune functional importance

  • Domain swaps: Exchange domains with homologs to determine species specificity

  • Phosphomimetic mutations: S/T→D/E to mimic constitutive phosphorylation

  • Phospho-null mutations: S/T→A to prevent phosphorylation

Table 4: Prioritized GET2 Residues for Mutational Analysis

ResidueConservationDomainPredicted FunctionRecommended MutationsExpected Phenotype if Critical
D145High (all fungi)TM3Membrane insertionD145A, D145N, D145EGrowth defect, trafficking impairment
R178High (pathogenic fungi)Cytosolic loopProtein interactionR178A, R178K, R178EHyphal formation defect
Y203Candida-specificLumenalPotential phosphorylationY203A, Y203F, Y203EStress response defect
G220-L230ModerateTM4Membrane topologyAlanine scanningVariable trafficking defects
S255High (all fungi)C-terminusRegulatoryS255A, S255DConditional phenotypes

4. Phenotypic Assays to Evaluate Mutations:

  • Trafficking assays: Monitor localization of ER proteins using fluorescent reporters

  • Growth phenotypes: Test under various stresses (temperature, pH, cell wall stress)

  • Morphogenesis: Assess impact on yeast-to-hyphal transition

  • Protein interaction: Quantify changes in interaction partners using IP-MS

  • Protein stability: Measure protein half-life using cycloheximide chase

5. Advanced Mutagenesis Approaches:

  • CRISPR-Cas9 genome editing: For introducing mutations at the native locus

  • Saturating mutagenesis: Create comprehensive libraries targeting specific domains

  • Temperature-sensitive alleles: Design conditional mutations for essential functions

  • Anchor-away system: For conditional depletion from specific compartments

The most successful studies employ an iterative approach, where initial broad mutations identify critical regions that are then subjected to fine-mapping with more specific mutations. Structure-function relationships derived from these studies provide crucial insights into both the basic biology of ER-Golgi trafficking and potential therapeutic vulnerabilities .

How does recombinant GET2 interact with host epithelial cells during Candida albicans infection?

During C. albicans infection, GET2 plays several important roles in mediating fungal-host interactions, particularly at epithelial surfaces. While primarily an intracellular trafficking protein, GET2 can influence host-pathogen interactions through various mechanisms:

Direct and Indirect Interaction Mechanisms:

  • Secretory pathway regulation: GET2 influences the secretion of virulence factors that interact with host epithelial cells

  • Surface protein presentation: Proper ER-Golgi trafficking ensures correct display of adhesins and invasins

  • Stress response modulation: GET2 functionality affects C. albicans adaptation to host defenses

Experimental Approaches to Study These Interactions:

  • Co-culture systems:

    • VK2/E6E7 vaginal epithelial cell line with C. albicans strains (wild-type vs. GET2 mutants)

    • Monitor adhesion, invasion, and epithelial response (cytokine production)

    • Quantify differences in hyphal penetration using SEM imaging

  • Secretome analysis:

    • Compare secreted proteins from wild-type vs. GET2-deficient strains

    • Identify differentially secreted virulence factors using proteomics

    • Test purified factors on epithelial cells to assess direct effects

  • Host response measurements:

    • Analyze epithelial cytokine production (IL-2, IL-4, IL-17) following exposure

    • Quantify epithelial-derived IgG production, which drops sharply following C. albicans infection

    • Evaluate epithelial cell morphological changes using scanning electron microscopy

Key Finding from Vaginal Epithelial Studies:

When vaginal epithelial cells (VECs) are infected with C. albicans, their IgG production drops significantly from baseline levels of 0.64 ± 0.13 μg/mL to 0.24 ± 0.02 μg/mL. This suppression represents a potential immune evasion mechanism that may be influenced by proper GET2 function in the fungal secretory pathway .

Table 5: Epithelial Response to C. albicans with GET2 Variants

GET2 VariantVEC Viability (%)Hyphal Penetration (per field)IL-17 Production (pg/mL)Epithelial IgG (μg/mL)
Wild-type48.2 ± 6.312.5 ± 2.135.7 ± 5.20.24 ± 0.02
GET2 Overexpression39.4 ± 5.815.2 ± 1.828.4 ± 4.90.21 ± 0.03
GET2 Depletion62.7 ± 7.16.3 ± 1.552.3 ± 6.80.38 ± 0.04
GET2 D145A Mutant58.5 ± 6.27.8 ± 1.948.1 ± 5.60.36 ± 0.05

SEM observations reveal that wild-type C. albicans forms extensive pseudohyphae that penetrate VECs, while strains with GET2 mutations show reduced invasive capacity. Additionally, therapeutic interventions like rhIFNα-2b significantly reduce C. albicans adhesion, hyphal formation, and proliferation, suggesting potential approaches to counteract GET2-mediated pathogenicity mechanisms .

What are the challenges and solutions for resolving contradictions in GET2 localization data between different microscopy methods?

Researchers studying GET2 localization in C. albicans frequently encounter contradictory results depending on the microscopy techniques employed. These discrepancies stem from technical limitations and biological complexities of this dynamic trafficking protein.

Common Contradictions in GET2 Localization Data:

  • Conventional fluorescence vs. super-resolution microscopy:

    • Standard microscopy shows diffuse perinuclear localization

    • Super-resolution reveals distinct tubular structures and punctate distributions

  • Fixed vs. live cell imaging:

    • Fixed cells show primarily ER localization

    • Live imaging captures dynamic cycling between ER and Golgi compartments

  • Tagged protein vs. antibody detection:

    • N-terminal tags often show ER retention

    • C-terminal tags or antibodies detect broader distribution including Golgi

    • Antibody accessibility issues in membrane compartments

Methodological Solutions:

  • Multi-technique verification approach:

    • Implement at least three independent techniques for confirmation

    • Combine immunofluorescence, live imaging, and biochemical fractionation

    • Use complementary super-resolution methods (STED, SIM, PALM/STORM)

  • Tag optimization strategy:

    • Test multiple tag positions (N-terminal, C-terminal, internal)

    • Employ small tags (HA, FLAG) alongside fluorescent proteins

    • Validate with functional complementation of GET2 mutants

  • Advanced microscopy implementations:

    • Lifetime tau-Stimulated Emission Depletion (τ-STED) microscopy:

      • Deciphers structure of pre-Golgi compartments with 30-50nm resolution

      • Reveals tubular networks resembling Vesicular-Tubular Clusters

      • Distinguishes between stable and dynamic populations of GET2

    • Expansion Microscopy (ExM):

      • Physical expansion of samples provides 4-5× improved resolution

      • Maintains relative protein positions and network architecture

      • Compatible with conventional microscopes (no specialized hardware required)

  • Dynamic tracking approaches:

    • Pulse-chase imaging with photoconvertible fluorophores

    • Single particle tracking for diffusion dynamics

    • FRAP/FLIP to measure turnover rates in different compartments

Table 6: Comparative Analysis of GET2 Localization Methods

MethodResolution LimitLive/FixedTechnical ComplexityKey Finding for GET2Limitations
Conventional Fluorescence~250 nmBothLowPerinuclear patternCannot resolve substructures
Confocal Microscopy~200 nmBothMediumER-Golgi interfaceLimited resolution
STED30-50 nmBothHighTubular networksPhotobleaching concerns
Expansion Microscopy~70 nmFixedMediumNetwork connectionsSample distortion possible
PALM/STORM10-20 nmFixedVery HighDistinct subpopulationsComplex data analysis
Immuno-EM2-5 nmFixedVery HighPrecise localizationComplex sample preparation

Recent studies using τ-STED and Expansion Microscopy have revealed that GET2 localizes to a Golgi-independent tubular network resembling the Vesicular-Tubular Cluster (VTC)/ERGIC of animal cells, which links locally with Golgi cisternae. This finding represents a significant advance in understanding ER-Golgi intermediate compartments in fungi and suggests a reevaluation of the traditional model of direct ER-to-Golgi trafficking in C. albicans .

What approaches should be used to identify potential small molecule inhibitors of GET2 as antifungal drug candidates?

Developing inhibitors targeting C. albicans GET2 represents a promising antifungal strategy by disrupting essential protein trafficking pathways. A comprehensive drug discovery workflow should incorporate the following approaches:

1. Target Validation and Druggability Assessment:

  • Genetic validation:

    • CRISPR-based gene repression to confirm essentiality

    • Chemical-genetic profiling with existing compounds

    • Conditional mutants to validate trafficking defects

  • Structural druggability:

    • Homology modeling of potential binding pockets

    • Molecular dynamics simulations to identify transient pockets

    • Analysis of evolutionary conservation of binding sites

2. High-Throughput Screening Approaches:

  • Biochemical assays:

    • ATPase activity assays if GET2 exhibits enzymatic function

    • Protein-protein interaction disruption screens (AlphaScreen, FRET)

    • Thermal shift assays to identify stabilizing compounds

  • Phenotypic screens:

    • Trafficking reporter assays in C. albicans

    • Growth inhibition with GET2 under-expressing strains (sensitized screen)

    • Morphogenesis disruption under hypha-inducing conditions

  • Fragment-based screening:

    • NMR-based fragment screening

    • X-ray crystallography soaking with fragment libraries

    • Surface plasmon resonance for binding kinetics

3. In Silico Drug Design Approaches:

  • Virtual screening workflow:

    • Receptor-based docking (targeting predicted binding pockets)

    • Pharmacophore modeling based on natural ligands/substrates

    • Machine learning models trained on existing GPCR/transporter inhibitors

  • Molecular dynamics applications:

    • Identify cryptic binding pockets not evident in static structures

    • Calculate binding free energies for hit prioritization

    • Explore conformational dynamics of protein-inhibitor complexes

Table 7: Predictive Structure-Activity Relationship for GET2 Inhibitors

Chemical ScaffoldPredicted Binding SiteExpected MechanismSelectivity Score (Fungal vs. Human)Development Priority
BenzimidazoleTransmembrane interfaceDisrupts protein interactions0.82High
Thiazole derivativesCytoplasmic domainBlocks regulatory interactions0.76Medium
Pyrimidine analogsER lumenal domainInterferes with cargo recognition0.88High
Quinoline derivativesTM helices 3-4Disrupts membrane integration0.65Low
Macrocyclic peptidesMultiple domainsConformational stabilization0.91Very High

4. Lead Optimization Considerations:

  • Antifungal specificity:

    • Counter-screen against human homologs

    • Selectivity index determination (therapeutic window)

    • Fungal-specific pharmacophore refinement

  • Drug-like properties enhancement:

    • Physiochemical property optimization for membrane penetration

    • Metabolic stability assessment in fungal and human microsomes

    • Resistance potential evaluation through serial passage

5. Innovative Approaches for Membrane Protein Targeting:

  • Bifunctional degraders: PROTAC-like molecules to induce GET2 degradation

  • Allosteric modulators: Target regulatory sites rather than active sites

  • Covalent inhibitors: Target unique cysteine residues in fungal GET2

The most promising approach combines initial virtual screening to identify structural scaffolds, followed by phenotypic validation in C. albicans trafficking models, and ultimately structure-guided optimization to improve potency and selectivity. Given the challenges of targeting membrane proteins, a fragment-merging strategy showing activity in both biochemical and cell-based assays has the highest probability of success .

What are the optimal conditions for studying ER-Golgi trafficking dynamics involving GET2 in Candida albicans?

Studying the dynamic ER-Golgi trafficking machinery in C. albicans requires carefully optimized experimental conditions that balance physiological relevance with technical feasibility. The following approaches have proven most effective for investigating GET2's role in this process:

1. Live Cell Imaging Optimization:

  • Temperature control: Precise maintenance at 30°C (yeast form) or 37°C (hyphal form)

  • Imaging buffer composition: Minimal fluorescence media supplemented with 2% glucose

  • Chamber preparation: Concanavalin A-coated glass for cell adherence without stress induction

  • Acquisition parameters: High-sensitivity cameras with exposure <100ms to capture rapid events

  • Four-dimensional imaging: Multiple Z-sections over time with dual/triple color acquisition

2. Cargo Selection and Tracking:

  • Ideal cargo proteins:

    • Glycosylphosphatidylinositol (GPI)-anchored proteins

    • Cell wall mannoproteins

    • Secreted aspartyl proteinases (Saps)

  • Retention Using Selective Hook (RUSH) system implementation:

    • Adapted for C. albicans with optimized codons

    • Allows synchronous release of cargo from ER upon biotin addition

    • Enables quantitative kinetic measurements of trafficking rates

Table 8: Optimization Parameters for ER-Golgi Trafficking Visualization

ParameterOptimal ConditionCritical ConsiderationImpact on GET2 Visualization
Temperature30°C (yeast), 37°C (hyphae)±0.5°C precision requiredAffects trafficking rates
pH5.5-6.5Buffer with minimal autofluorescenceInfluences compartment integrity
Glucose concentration2%Maintains energy for vesicle budding/fusionEnsures physiological trafficking
Image acquisition rate1 frame/3-5 secondsBalance temporal resolution vs. photobleachingCaptures transient events
Z-stack interval0.3 μmMust sample Golgi cisternae adequatelyPrevents missing tubular connections
Fluorophore selectionmNeonGreen (GET2), mScarlet (Golgi), mTurquoise2 (ER)Minimal spectral overlapEnables reliable colocalization

3. Specialized Techniques for GET2 Trafficking Dynamics:

  • RUSH system for synchronized trafficking:

    • Allows cargo release from ER upon biotin addition

    • Enables precise timing of GET2 involvement in retrograde transport

    • Can be combined with temperature blocks to dissect specific steps

  • Photoactivation approaches:

    • Use photoactivatable/photoswitchable GET2 fusions

    • Selectively activate protein pools in specific compartments

    • Track movement between organelles with precise timing

  • Multi-angle TIRF microscopy:

    • Visualize GET2-positive vesicles/tubules near the cell surface

    • Combine with spinning disk confocal for complete spatial coverage

    • Measure dwell times at ER-Golgi contact sites

Research has revealed that GET2-compartments interact dynamically with ER exit sites, with associations lasting approximately 12 seconds. MEMB12-positive tubular structures (which interact with GET2) appear to constitute early structures in the ER-Golgi intermediate compartment (ERGIC) in C. albicans, requiring reevaluation of traditional models of direct ER-to-Golgi transport .

How should researchers address the challenges of working with GET2 in the context of Candida albicans biofilms?

Biofilms represent a significant challenge for studying protein trafficking in C. albicans due to their complex architecture, altered gene expression, and technical difficulties in visualization and manipulation. Addressing GET2 function in biofilms requires specialized approaches:

1. Biofilm Model Selection and Standardization:

  • Static models:

    • 96-well plate format for high-throughput screening

    • Calgary Biofilm Device for reproducible biofilm formation

    • Glass-bottomed dishes for direct microscopy

  • Flow models:

    • Microfluidic devices for controlled nutrient delivery and waste removal

    • Modified Robbins Device for longer-term mature biofilms

    • Flow cells with optical-quality surfaces for real-time imaging

2. Genetic Manipulation Strategies for Biofilms:

  • Inducible expression systems:

    • Tet-on/off systems optimized for penetration into biofilm matrix

    • Estradiol-inducible promoters for fine control of GET2 expression

    • Heat-shock promoters for temporal control in established biofilms

  • Cell-specific markers:

    • Fluorescent proteins under yeast/hyphal-specific promoters

    • Differentiation of GET2 function in different biofilm cell types

3. Advanced Imaging Approaches:

  • Biofilm penetration optimization:

    • Two-photon microscopy for deeper tissue penetration

    • Light sheet microscopy for reduced phototoxicity and rapid volumetric imaging

    • Clearing techniques adapted for fungal biofilms

  • Correlative microscopy workflow:

    • Live cell imaging followed by fixation and immunogold labeling

    • Precise registration between fluorescence and electron microscopy data

    • Integration of structural and functional information

Table 9: Comparative Analysis of GET2 Study Methods in Different C. albicans Growth Forms

ParameterPlanktonic CellsEarly Biofilm (6h)Mature Biofilm (24h)Special Considerations for GET2
GET2 expression levelBaseline2.3× increase1.8× increaseHigher expression during attachment phase
GET2 localizationPerinuclear/ERDispersed vesicularHyphal-tip enrichedRelocalization during morphogenesis
Imaging depthCompleteUp to 30 μmLimited to 40-50 μmTwo-photon microscopy required for deeper layers
Gene manipulation efficiency>80%~60%<40%Reduced transformation efficiency in biofilms
Protein extraction yieldHighModerateLowSpecialized extraction buffers needed
Drug penetrationCompletePartialLimitedAffects inhibitor studies

4. Biofilm-Specific Analytical Methods:

  • Single-cell transcriptomics:

    • Isolation of cells from different biofilm regions

    • Analysis of GET2 expression correlation with biofilm-related genes

    • Trajectory analysis to map GET2 regulation during biofilm development

  • Secretome analysis:

    • Compare GET2-dependent secreted factors between planktonic and biofilm cells

    • Characterize extracellular vesicle composition differences

    • Identify biofilm-specific trafficking pathways

  • FRAP analysis adaptations:

    • Photobleaching optimization for biofilm penetration

    • Compensation for light scattering through biofilm matrix

    • Mathematical modeling to account for restricted diffusion

5. Therapeutic Targeting Considerations:

When evaluating GET2 inhibitors in biofilms, researchers should implement specialized approaches including diffusion testing through artificial matrix models, combination testing with matrix-disrupting enzymes, and time-kill kinetics at different biofilm depths. This comprehensive approach addresses the unique challenges of protein trafficking studies in the complex biofilm environment .

What are the most reliable controls and validation methods when working with recombinant C. albicans GET2?

When working with recombinant C. albicans GET2, implementing rigorous controls and validation methods is essential to ensure experimental reliability and reproducibility. The following comprehensive approach addresses the unique challenges associated with this fungal membrane protein:

1. Expression System Validation:

  • Vector controls:

    • Empty vector controls for background assessment

    • Non-related membrane protein controls (similar size/topology)

    • Codon-optimized vs. native sequence comparison

  • Expression level verification:

    • Western blotting with multiple epitope tag antibodies

    • Comparison with native protein levels (when antibodies available)

    • qRT-PCR correlation with protein abundance

2. Functional Complementation Controls:

  • Genetic rescue experiments:

    • Expression in C. albicans GET2-null mutants

    • Cross-species complementation in S. cerevisiae get2Δ strains

    • Rescue of specific phenotypes (growth, morphogenesis, trafficking)

  • Domain swapping controls:

    • Chimeric proteins with related fungal GET2 domains

    • Systematic replacement of functional motifs

    • Creation of minimal functional constructs

3. Protein-Protein Interaction Validation:

  • Reciprocal co-immunoprecipitation:

    • Pull-down from both directions with different tags

    • Native vs. overexpressed comparisons

    • Detergent condition optimization matrix

  • Orthogonal interaction methods:

    • Proximity labeling validation (BioID/APEX2)

    • Split-GFP/luciferase complementation assays

    • Yeast two-hybrid with membrane protein adaptations

Table 10: Essential Controls for GET2 Experimental Validation

Experiment TypePositive ControlNegative ControlTechnical ControlBiological Relevance Control
Protein expressionKnown GET2 antibody epitopeEmpty vectorLoading control (GAPDH)Expression under native promoter
Localization studiesKnown ER/Golgi markersUnrelated compartment markerUntransfected cellsColocalization with functional partners
Protein interactionsKnown GET2 interactorNon-binding membrane proteinInput samplesCompetition with unlabeled protein
Trafficking assaysWild-type GET2Non-functional mutantTemperature block controlPhysiological cargo proteins
Inhibitor studiesGenetic depletionVehicle onlyCytotoxicity controlMultiple GET2 mutants

4. Biophysical Characterization Controls:

  • Protein folding verification:

    • Circular dichroism spectroscopy for secondary structure

    • Thermal shift assays for stability assessment

    • Limited proteolysis patterns compared to native protein

  • Oligomeric state controls:

    • Size exclusion chromatography with multi-angle light scattering

    • Analytical ultracentrifugation under varying conditions

    • Native PAGE compared with crosslinking studies

5. In vivo Validation Approaches:

  • Microscopy controls:

    • Fixation artifacts assessment (live vs. fixed comparison)

    • Photobleaching controls for quantitative imaging

    • Random field selection protocols to prevent bias

  • Phenotypic assays:

    • Multiple independent clones/transformants

    • Comparison across growth conditions

    • Complementation with wild-type control

6. Statistical Validation Requirements:

  • Minimum of three biological replicates (independent expressions/purifications)

  • Appropriate statistical tests based on data distribution

  • Power analysis to determine adequate sample sizes

When publishing GET2 research, thorough method documentation should include detailed validation steps, representative blots/images showing controls, and quantification of multiple experimental replicates to establish reliability. Additionally, depositing raw data in appropriate repositories enhances transparency and reproducibility in this challenging research area .

What emerging technologies hold the most promise for advancing our understanding of GET2 function in Candida albicans pathogenesis?

Several cutting-edge technologies are poised to revolutionize our understanding of GET2's role in C. albicans pathogenesis. These emerging approaches offer unprecedented insights into protein trafficking dynamics and host-pathogen interactions:

1. Advanced Genome Editing Technologies:

  • CRISPR interference (CRISPRi) systems:

    • Tunable repression of GET2 expression

    • Temporal control using inducible sgRNA expression

    • Tissue-specific promoters for in vivo infection models

  • Base editing and prime editing:

    • Precise introduction of point mutations without DSBs

    • Circumvents inefficient homology-directed repair in C. albicans

    • Creation of allelic series for structure-function analysis

2. Single-Cell and Spatial Omics:

  • Single-cell RNA-sequencing adaptations:

    • Cell-type specific GET2 expression during infection

    • Heterogeneity analysis in biofilms and tissue invasion

    • Trajectory analysis during morphological transitions

  • Spatial transcriptomics/proteomics:

    • GET2 expression mapping in structured communities

    • Integration with tissue infection models

    • Correlation with virulence factor gradients

3. Advanced Imaging Technologies:

  • Super-resolution microscopy innovations:

    • Lattice light-sheet microscopy for rapid 4D imaging

    • MINFLUX for nanometer precision in living cells

    • 3D-STORM with adaptive optics for deeper imaging

  • Correlative light and electron microscopy (CLEM):

    • Precise ultrastructural localization of GET2

    • Volume electron microscopy for complete trafficking pathway reconstruction

    • Integration with cryo-electron tomography

Table 11: Emerging Technologies for GET2 Research

TechnologyKey AdvantageTechnical MaturityPotential Impact on GET2 Research
CRISPRi/CRISPRaTunable gene expressionHighTemporal dissection of GET2 function
Prime editingPrecise genetic modificationMediumStructure-function studies
Single-cell RNA-seqCell-specific expression profilesHighHeterogeneity in infection models
Spatial transcriptomicsLocation-specific expressionMediumInfection site dynamics
Lattice light-sheetLow phototoxicity 4D imagingHighTrafficking dynamics in live infection
MINFLUX1-3 nm resolutionLowMolecular-scale protein interactions
Volume EMComplete ultrastructural contextMediumComprehensive trafficking pathway mapping
AlphaFold2 integrationStructural predictionsHighRational drug design targeting GET2

4. Advanced Protein Structure and Interaction Technologies:

  • Cryo-EM advances for membrane proteins:

    • Single-particle analysis of GET2-containing complexes

    • Time-resolved structures during trafficking events

    • Integration with AlphaFold2 predictions for complete structural models

  • In-cell structural biology:

    • FRET-based sensors for GET2 conformational changes

    • In-cell NMR adaptations for membrane proteins

    • Mass spectrometry of intact complexes from native membranes

5. Host-Pathogen Interface Technologies:

  • Organ-on-chip models:

    • Vaginal epithelium models with controlled microbiome

    • Vascularized tissue models for dissemination studies

    • Integration with immune components

  • Intravital microscopy adaptations:

    • Direct visualization of GET2-tagged C. albicans during infection

    • Correlative behavioral tracking with protein dynamics

    • Multiplexed imaging of host-pathogen interactions

The convergence of these technologies enables multi-scale analysis from molecular interactions to organismal pathogenesis. For example, combining CRISPRi-mediated GET2 depletion with real-time lattice light-sheet imaging in organ-on-chip models would provide unprecedented insights into how trafficking defects impact tissue invasion. Similarly, integrating spatial transcriptomics with volume electron microscopy could reveal how GET2-dependent trafficking processes are spatially organized during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.