Recombinant Candida albicans GPI inositol-deacylase (BST1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Candida albicans GPI Inositol-Deacylase (BST1)

Recombinant Candida albicans GPI inositol-deacylase (BST1) is an enzyme in Candida albicans that facilitates the cell wall anchorage of glycosylphosphatidylinositol-anchored proteins (GPI-APs) through inositol deacylation . BST1 is crucial for host invasion and immune escape .

Function and Mechanism

  • Inositol Deacylation: BST1 functions as an inositol deacylase, modifying GPI-APs by removing an acyl chain from the inositol moiety . This modification is essential for GPI-APs to attach to the cell wall properly .

  • Cell Wall Anchorage: By deacylating inositol, BST1 helps GPI-APs target and anchor to the cell wall .

  • Role in Host Infection: BST1 is critical for the ability of Candida albicans to infect its host . Deletion of BST1 results in impaired cell wall anchorage of GPI-APs, leading to the unmasking of β-(1,3)-glucan . This aberrant cell wall structure impairs the invasive ability of C. albicans and makes it more susceptible to recognition by the host's immune system .

Impact on Virulence

  • Reduced Virulence: Candida albicans strains deficient in BST1 exhibit attenuated virulence in systemic candidiasis models .

  • Invasive Ability: BST1 is required for the invasive ability of C. albicans . Mutants lacking BST1 show a significant decrease in the attachment of GPI-APs to the cell wall, which impairs their ability to invade host cells .

  • Immune Recognition: Defective inositol deacylation enhances the recognition of C. albicans by the host immune system . The bst1Δ/Δ mutant strain displays diminished virulence in hematogenously disseminated candidiasis, due to both impaired invasive ability and enhanced immunogenicity .

Experimental Evidence

  • Sensitivity to PI-PLC: The sensitivity of GPI-APs to phosphoinositide-phospholipase C (PI-PLC) is used to evaluate the level of inositol deacylation . GPI-APs become sensitive to PI-PLC after inositol deacylation, which can be detected through phase separation using Triton X-114 .

  • Site-Directed Mutagenesis: Mutating the catalytic site of BST1 (serine-202) to alanine results in GPI-APs exhibiting resistance to PI-PLC, similar to bst1 null mutants . This confirms the role of BST1 in inositol deacylation of GPI-APs .

  • Mouse Model Studies: In a mouse model of hematogenously disseminated candidiasis, mice infected with bst1Δ/Δ mutant strains showed no mortality, while those infected with parent and complemented strains had median survival times of 8 and 17 days, respectively . The fungal burden in the kidneys and livers of mice infected with bst1 mutants was significantly lower than in those infected with parent or complemented strains . Histopathological reviews confirmed lower fungal burdens and reduced presence of C. albicans filaments in the kidneys of mice infected with the bst1Δ/Δ mutant strain .

Relevance to Drug Development

BST1 represents a potential target for developing new antifungal drugs . Inhibiting inositol deacylation of GPI-APs could impair the invasive ability of C. albicans and enhance its recognition by the host immune system, offering a novel approach to treating systemic candidiasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BST1; CAALFM_C104190CA; CaO19.1053; CaO19.8655; GPI inositol-deacylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
BST1
Target Protein Sequence
MLSKRLFPYSNLFPRSRKYKFIVYFIICLTIIISALGVYLYSIPIVSPNQPQCDMVWMSP SYARIRAFDETHTKYASKYNLYLYREQDVDKMPNENENEDGNEGFTSLDGIPALFIHGNA GSFEQVRSIAARCSEMYYTDGKFKEKYPHARNIDFFTADFNEELSAFKGLRDQVEYVTQA ISFIVDLYPQNPNRNIILIGHSMGGLVARIAASRQQHESNVDIILTLATPHSDPFPWLPK TSDFPDEVGLISIYSSVDLMVPPSVVTPKSKSDHFFSVDAAKLLGVPIDHQGIVWCGQLR EKLSEALIGISGLNTLQDRMKVFKKIFSGDRKELGPTPIFGLAKLKLKLLQSWVHLLSLT IFALKWTIIVLAIIQLRKVYTKFNNPPPTH
Uniprot No.

Target Background

Function

Function: Involved in the inositol deacylation of GPI-anchored proteins. This process plays a crucial role in the quality control and ER-associated degradation (ERAD) of GPI-anchored proteins.

Database Links
Protein Families
GPI inositol-deacylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of BST1 in Candida albicans pathogenicity?

BST1 (Bypass of Sec Thirteen 1) functions as an inositol deacylase of GPI-anchored proteins (GPI-APs) in Candida albicans. It plays a critical role in facilitating cell wall anchorage of GPI-APs through inositol deacylation, which is essential for proper cell wall structure. Unlike its mammalian counterpart PGAP1, BST1 in C. albicans is required for normal cell surface expression of GPI-APs, making it integral to the pathogen's virulence mechanisms. BST1-deficient C. albicans (bst1Δ/Δ) exhibits severely impaired cell wall anchorage of GPI-APs and unmasked β-(1,3)-glucan, resulting in abolished invasive ability and enhanced recognition by host immune systems .

How does the molecular mechanism of BST1-mediated inositol deacylation work?

BST1 mediates inositol deacylation by removing the acyl chain linked to the inositol moiety of GPI-anchored proteins after the attachment of terminal ethanolamine phosphate (EtNP) to the proteins. This process occurs in the endoplasmic reticulum shortly after GPI-anchor attachment during the second phase of GPI-APs biosynthesis. The catalytic site of BST1 in C. albicans has been identified as serine-202, which corresponds to serine-236 in S. cerevisiae and serine-174 in human PGAP1. When this serine is mutated to alanine (S202A), the enzyme loses its inositol deacylation activity, demonstrating its essential role in the catalytic mechanism .

What happens to GPI-anchored proteins when BST1 function is lost?

When BST1 function is lost, GPI-anchored proteins undergo several critical changes:

  • GPI-APs become resistant to phosphoinositide-phospholipase C (PI-PLC), indicating defective inositol deacylation

  • The cell wall anchorage of GPI-APs is severely impaired

  • β-(1,3)-glucan becomes unmasked on the cell surface

  • Altered cell wall architecture disrupts the normal invasive ability of C. albicans

  • The modified cell surface becomes more readily recognized by host immune systems

These changes collectively contribute to severely attenuated virulence as demonstrated in murine models of systemic candidiasis, where BST1 null mutants showed significantly reduced kidney and liver fungal burdens compared to wild-type strains .

How can researchers effectively evaluate BST1 function in laboratory settings?

A comprehensive evaluation of BST1 function requires multiple complementary approaches:

  • PI-PLC sensitivity assay: This primary method assesses inositol deacylation by measuring the sensitivity of GPI-APs to PI-PLC treatment. Following proper inositol deacylation, GPI-APs become sensitive to PI-PLC and partition into the aqueous phase when separated using Triton X-114 .

  • ConA-staining of GPI-APs: Peroxidase-labeled concanavalin A (ConA) binds to mannose residues of GPI-anchors, allowing visualization of GPI-APs. BST1-deficient strains show resistance to PI-PLC when analyzed by this method .

  • Cell wall composition analysis: Evaluating changes in β-(1,3)-glucan exposure provides indirect evidence of BST1 function, as defective inositol deacylation leads to unmasked β-glucan.

  • In vivo virulence assessment: Using mouse models of systemic candidiasis to compare survival rates, organ fungal burden, and histopathological changes between wild-type, BST1-deficient, and complemented strains .

What are the key considerations when designing BST1 knockout and complementation experiments?

When designing BST1 genetic manipulation experiments, researchers should consider:

  • Generation of complete knockout strains: Creating bst1Δ/Δ strains requires deletion of both alleles in the diploid C. albicans genome.

  • Catalytic site mutants: Generating strains with point mutations in the catalytic site (S202A) provides evidence that phenotypes are specifically due to loss of enzymatic activity rather than structural roles .

  • Complementation controls: Creating bst1Δ/Δ::BST1 complemented strains is essential to confirm that phenotypic changes are due to BST1 deletion and not secondary mutations.

  • Verification methods:

    • PCR verification of gene deletion

    • Functional assays such as PI-PLC sensitivity tests to confirm loss of enzymatic activity

    • Western blotting if antibodies are available

  • Phenotypic characterization: Systematically comparing wild-type, knockout, and complemented strains for:

    • Cell wall GPI-AP localization

    • β-glucan exposure

    • Hyphal formation capacity

    • Invasive ability in relevant models

    • Virulence in animal models

What methodological approaches can be used to study BST1's role in GPI biosynthesis?

To investigate BST1's role in GPI biosynthesis, researchers can employ:

  • Biochemical analysis of GPI intermediates: Using techniques like thin-layer chromatography or mass spectrometry to analyze accumulation of specific GPI biosynthesis intermediates in BST1-deficient strains.

  • Metabolic labeling: Using radioactive precursors (e.g., [3H]inositol) to track the fate of GPI intermediates and identify where BST1 deficiency creates metabolic blocks.

  • Subcellular localization studies: Determining BST1 localization within the ER using fluorescent protein fusions or immunofluorescence microscopy.

  • Genetic interaction studies: Creating double mutants with defects in other GPI biosynthesis genes to reveal synthetic interactions, epistatic relationships, or redundancies.

  • Structural studies: Using purified recombinant BST1 for crystallography or cryo-EM to understand the enzyme's catalytic mechanism and substrate binding.

How does BST1 deficiency affect host immune recognition of Candida albicans?

BST1 deficiency profoundly impacts the immunological recognition of C. albicans through multiple mechanisms:

Strainβ-glucan ExposureImmune RecognitionKidney Fungal BurdenTissue Invasion
Wild-typeMaskedNormalHighExtensive filaments
bst1Δ/ΔUnmaskedEnhancedSignificantly reducedFew/no filaments
BST1(S202A)UnmaskedEnhancedSignificantly reducedFew/no filaments
bst1Δ/Δ::BST1MaskedNormalPartially restoredPresent filaments

What potential does BST1 inhibition hold as an antifungal strategy?

BST1 inhibition presents several promising aspects as an antifungal strategy:

  • Dual mechanism of action: BST1 inhibition simultaneously reduces fungal invasive capacity and enhances immune recognition and clearance .

  • Potential synergy with existing antifungals: Research suggests BST1-deficient strains show increased sensitivity to azole antifungals, indicating potential for combination therapy approaches.

  • Specificity advantages: Differences between fungal BST1 and mammalian PGAP1 in terms of functional importance could allow for selective targeting with minimal host toxicity.

  • Reduced virulence: Studies in mouse models demonstrate that BST1-deficient strains exhibit severely attenuated virulence, with no mortality observed over a 30-day period compared to wild-type strains (median survival 8 days) .

Research directions for BST1-based antifungal development should include:

  • Structural characterization of BST1 through crystallography

  • High-throughput screening for selective inhibitors

  • In vivo evaluation of lead compounds

  • Assessment of resistance development potential

How might environmental and stress conditions influence BST1 function?

The regulation of BST1 expression and activity under different environmental and stress conditions remains an important area for investigation. Key research considerations include:

  • Transcriptional regulation: Analyzing BST1 expression under various conditions:

    • Different carbon sources

    • Nutrient limitation

    • pH stress

    • Oxidative stress

    • Antifungal exposure

    • Host-mimicking conditions

  • Post-translational modifications: Investigating whether BST1 activity is modulated by phosphorylation, glycosylation, or other modifications during stress responses.

  • Integration with stress response pathways: Exploring connections between cell wall integrity pathways, unfolded protein response, and BST1 function.

  • Adaptation during infection: Examining how BST1 activity might be modulated during different stages of infection or in different host niches.

Understanding these regulatory aspects could reveal additional vulnerabilities for therapeutic targeting and provide insights into how C. albicans adapts BST1 activity during pathogenesis.

What are the optimal protocols for producing and purifying recombinant BST1?

For producing and purifying recombinant BST1:

  • Expression system selection:

    • Yeast systems: Pichia pastoris or S. cerevisiae provide appropriate post-translational modifications

    • Insect cell systems: Sf9 or High Five cells using baculovirus for complex eukaryotic proteins

    • Mammalian systems: HEK293 or CHO cells for highest fidelity to native folding

  • Construct design considerations:

    • Removal of N-terminal ER signal sequence and C-terminal ER retention signals for cytoplasmic expression

    • Inclusion of appropriate tags (His6, GST) for purification

    • TEV or PreScission protease sites for tag removal

    • Mutation of the catalytic site (S202A) as a negative control

  • Purification workflow:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Tag cleavage and removal

    • Further purification via ion exchange chromatography

    • Size exclusion chromatography for final polishing

    • Activity verification using PI-PLC sensitivity assays

  • Activity preservation considerations:

    • Buffer optimization through thermal shift assays

    • Addition of stabilizing agents (glycerol, specific ions)

    • Avoidance of freeze-thaw cycles

How can researchers develop assays to measure BST1 enzymatic activity in vitro?

Developing a robust in vitro BST1 enzymatic activity assay requires:

  • Substrate preparation options:

    • Synthetic GPI intermediates with acylated inositol

    • Natural GPI-APs extracted from bst1Δ/Δ strains

    • Fluorescently or radioactively labeled substrates for enhanced detection

  • Reaction condition optimization:

    • Buffer composition screening (pH, ionic strength)

    • Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺)

    • Temperature optimization

    • Detergent type and concentration for substrate solubilization

  • Activity detection methods:

    • Direct methods:

      • Mass spectrometry to detect deacylated products

      • HPLC separation of substrate and product

    • Indirect methods:

      • PI-PLC sensitivity changes before and after BST1 treatment

      • Coupled enzyme assays that produce measurable signals

  • Controls and validation:

    • Heat-inactivated enzyme negative control

    • S202A mutant enzyme as catalytically inactive control

    • Known inhibitors if available

What approaches can be used to study BST1 substrate specificity?

To investigate BST1 substrate specificity:

  • Comparative analysis of different GPI-APs:

    • Test whether BST1 shows preferential deacylation of specific GPI-anchored proteins like Als1p versus others

    • Use mass spectrometry to analyze deacylation rates of different GPI-APs

  • Synthetic substrate variants:

    • Create modified GPI precursors with different:

      • Inositol acylation patterns

      • Lipid compositions

      • Glycan modifications

  • Chimeric enzyme studies:

    • Create fusion proteins between BST1 from C. albicans and homologs from other species

    • Map substrate specificity domains through activity assays with different substrates

  • Computational approaches:

    • Molecular docking simulations with potential substrates

    • Molecular dynamics studies of enzyme-substrate interactions

    • Identification of substrate-binding residues through conservation analysis

  • Mutagenesis studies:

    • Beyond the catalytic site (S202), identify and mutate potential substrate-binding residues

    • Create libraries of BST1 variants with altered specificity

How should researchers interpret PI-PLC sensitivity data in BST1 studies?

When analyzing PI-PLC sensitivity data:

  • Quantitative assessment: Rather than binary (sensitive/resistant) interpretation, quantify the percentage of GPI-APs that transfer to the aqueous phase after PI-PLC treatment.

  • Validation with multiple GPI-APs: Test multiple GPI-anchored proteins (e.g., Als1p) to ensure the observed effect is general rather than protein-specific .

  • Controls to include:

    • Wild-type strain (positive control for PI-PLC sensitivity)

    • bst1Δ/Δ strain (negative control for PI-PLC sensitivity)

    • BST1(S202A) catalytic mutant (should phenocopy the null mutant)

    • Complemented strain (should restore wild-type phenotype)

  • Technical considerations:

    • Ensure complete phase separation during Triton X-114 extraction

    • Maintain consistent PI-PLC concentrations and incubation times

    • Use appropriate detection methods (Western blotting, ConA staining) for the GPI-APs being studied

  • Interpretation framework:

    • Complete resistance to PI-PLC suggests total absence of inositol deacylation

    • Partial sensitivity suggests incomplete or selective deacylation

    • Changes in sensitivity under different conditions may indicate regulatory mechanisms

What statistical approaches are most appropriate for analyzing virulence data in BST1 studies?

For analyzing virulence data in BST1 studies:

  • Survival analysis:

    • Kaplan-Meier survival curves with log-rank tests for comparing survival distributions between wild-type, bst1Δ/Δ, BST1(S202A), and complemented strains

    • Sample size calculations based on expected effect sizes to ensure adequate statistical power

  • Organ fungal burden analysis:

    • Non-parametric tests (Mann-Whitney U) for comparing CFU counts when data doesn't follow normal distribution

    • Log transformation of CFU data before applying parametric tests

    • Multiple comparisons correction (e.g., Bonferroni) when comparing multiple strains

  • Histopathological assessment:

    • Blinded scoring systems for tissue invasion and inflammation

    • Quantitative image analysis of C. albicans filaments in tissue sections

    • Correlation analysis between histopathological findings and fungal burden

  • Data presentation recommendations:

    • Report both median survival times and statistical significance for survival curves

    • Present individual data points alongside means/medians for fungal burden

    • Include representative histopathological images with appropriate scale bars and annotations

How might BST1 research contribute to understanding other fungal pathogens?

BST1 research in C. albicans has broader implications for understanding other fungal pathogens:

What are the important considerations for translating BST1 research into potential therapeutics?

Key considerations for translating BST1 research into therapeutics include:

  • Target validation:

    • Confirming BST1's essentiality for virulence across diverse clinical isolates

    • Validating the importance of inositol deacylation in different infection models

    • Assessing potential compensatory mechanisms that might lead to resistance

  • Therapeutic approaches:

    • Small molecule inhibitors targeting BST1's catalytic activity

    • Peptide-based inhibitors disrupting protein-protein interactions

    • RNA interference or CRISPR-based approaches for gene silencing

  • Structural studies:

    • Determining BST1's crystal structure to enable structure-based drug design

    • Identifying binding pockets suitable for small molecule inhibitors

    • Comparing fungal BST1 with mammalian PGAP1 to design selective inhibitors

  • Delivery considerations:

    • Developing compounds with appropriate pharmacokinetic properties

    • Ensuring adequate tissue distribution to sites of infection

    • Addressing potential drug-drug interactions with existing antifungals

  • Pre-clinical evaluation framework:

    • Efficacy testing in multiple candidiasis models (systemic, mucosal, biofilm)

    • Combination studies with established antifungals

    • Safety assessment focusing on potential cross-reactivity with mammalian PGAP1

How can high-throughput approaches be applied to BST1 inhibitor discovery?

For high-throughput BST1 inhibitor discovery:

  • Assay development:

    • Adaptation of PI-PLC sensitivity assays to high-throughput format

    • Development of fluorescence-based readouts for inositol deacylation

    • Creation of cell-based reporter systems reflecting BST1 activity

  • Screening strategies:

    • Structure-based virtual screening against BST1 homology models

    • Fragment-based screening to identify initial chemical matter

    • Repurposing screens of approved drug libraries

    • Natural product extract libraries from fungal competitors

  • Hit validation workflow:

    • Confirmation of target engagement using recombinant BST1

    • Counter-screening against mammalian PGAP1 for selectivity

    • Analysis of effects on cell wall composition and β-glucan exposure

    • Assessment of impact on C. albicans virulence traits

  • Lead optimization considerations:

    • Structure-activity relationship studies guided by BST1 structural information

    • Improvement of pharmacokinetic properties while maintaining selectivity

    • Optimization of anti-Candida activity in relevant infection models

  • Combination potential:

    • Synergy screening with established antifungals

    • Identification of optimal drug combinations and dosing regimens

    • Development of dual-action molecules targeting BST1 and other pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.