Recombinant Candida albicans High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Oxidative Stress Response

  • Sho1 mutants exhibit hypersensitivity to oxidative stress but only partially depend on the Hog1 MAP kinase pathway for this response .

  • The Sln1-Ssk1 branch of the HOG pathway primarily mediates oxidative stress adaptation, with Sho1 playing a minor role .

Cell Wall Biogenesis and Morphogenesis

  • Cell Wall Integrity: sho1 mutants show increased sensitivity to cell wall inhibitors (Congo red, calcofluor white) and altered cell wall architecture, leading to cell aggregation .

  • Hyphal Growth: Sho1 is essential for filamentation under nitrogen starvation (SLAD medium) and mannitol-induced hyphal growth .

  • Biofilm Formation: Sho1 deletion reduces biofilm thickness by 40–60% and disrupts hyphal networks, critical for pathogenicity .

MAP Kinase Signaling

  • Hog1 Activation: Sho1 contributes weakly to Hog1 phosphorylation during osmotic stress, with Ssk1 being the dominant regulator .

  • Cek1 Activation: Sho1 is required for Cek1 MAP kinase activation during cell wall remodeling and stress recovery .

In Vitro Virulence Traits

PhenotypeSho1Δ/Δ Mutant vs. Wild-TypeReference
Biofilm thickness↓ 50–60%
Adhesion capacity↓ 30%
Flocculation ability↓ 45%

In Vivo Infection Models

  • Mouse Survival: Sho1 deletion extends survival by 35–40% in systemic infection models .

  • Organ Fungal Load:

    • Liver: ↓ 2.5-fold

    • Kidney: ↓ 3.1-fold

    • Spleen: ↓ 2.8-fold

Immune Modulation

Immune ParameterSho1Δ/Δ vs. Wild-TypeReference
M1/M2 macrophage ratio↓ 55%
Th1/Th2 cell ratio↑ 70%
Th17 cell count↓ 40%

Clinical Relevance

  • Expression Levels: SHO1 transcripts are elevated in clinical isolates from sterile fluids and sputum compared to lab strains (SC5314) .

  • Therapeutic Target: Sho1’s role in biofilm formation and immune evasion highlights its potential as an antifungal target .

Key Research Findings

  1. Genetic Interactions: Double ssk1 sho1 mutants retain Hog1 activation under osmotic stress, suggesting alternative HOG pathway inputs .

  2. Cek1 Constitutive Activity: hog1 and ssk1 mutants show hyperactivation of Cek1, correlating with Congo red resistance .

  3. Morphological Defects: Sho1-deficient cells exhibit abnormal budding under osmotic stress (50–80% elongated/swollen cells) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHO1; CAWG_00515; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Candida albicans (strain WO-1) (Yeast)
Target Names
SHO1
Target Protein Sequence
MGFSLSNFTSDPFAISTVSFGIMAWVVAIAGAASSKQENFPHFSWWGISYQIVIILIIFV LYANNNIELYKFTLVGLVSIAFIYTTNSTNNLIYNSNSAGNLCCAAGCILLSILNLIWIL YFGGHPESPTNQFIDSFSLRGQGHEQLGSGSHNHNANNANNNIPIGAGNAIIGKGEMSPY DDRFAASGVNQPTSESLRLASGPQMGNGPFTTTGAIINPNLQQPLSGSIGGSAHHTPTNI NNNNNNNTGYMTSSHLTGLENFSSPHVPGSGTGAGLGVGAGRDLTHNSNGGGGSGGGPAS ANNSNNTNKRNTIYTDSETGTGITFRYKAKALYSYDANPDDINEISFVKDEILEVDDIDG KWWQARRANGQVGICPSNYVKLLDT
Uniprot No.

Target Background

Function
This protein is a plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity. It also mediates resistance to oxidative stress and controls the activation of the CEK1 MAP kinase. Furthermore, SHO1 influences the molecular weight and polymer distribution of cell wall mannan. This protein is involved in invasive filamentation into semi-solid media and plays a crucial role in morphological dimorphic transition. This transition is a differentiation program characteristic of C. albicans and is known to be essential for pathogenesis.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Sho1 in Candida albicans?

Sho1 is a membrane protein in Candida albicans that functions as an upstream regulator of glycolysis and is required for Ras1-cAMP signaling. It plays a pivotal role in various physiological processes, including response to osmotic stress, oxidative stress, and temperature fluctuations . Significantly, Sho1 controls the Ras1-dependent expression of core microcolony genes involved in adhesion and virulence, establishing a novel regulatory function linking glycolysis to pathogenic microcolony formation .

Methodologically, to determine Sho1's function, researchers have employed gene knockout techniques followed by phenotypic characterization and molecular assays (e.g., measuring intracellular cAMP levels). Studies have shown that Sho1 deletion results in significantly reduced (approximately 3-fold) intracellular cAMP levels compared to wild-type cells, indicating its involvement in the cAMP signaling pathway .

How does Sho1 expression differ between clinical and laboratory strains?

RT-qPCR analysis reveals that Sho1 gene expression is significantly higher in clinical isolates of C. albicans compared to standard laboratory strains . Specifically, clinical strains derived from sterile fluids, secretions, and sputum demonstrate elevated Sho1 expression levels compared to the standard strain SC5314 .

For researchers investigating strain differences, the recommended approach is quantitative RT-PCR using appropriate reference genes for normalization. When comparing clinical isolates from different infection sites, no significant difference was observed in Sho1 expression levels among samples from sterile fluids, secretions, and sputum (p > 0.05), suggesting that elevated Sho1 expression is a general characteristic of clinical isolates regardless of isolation site .

What phenotypic changes occur when Sho1 is deleted in C. albicans?

Deletion of the Sho1 gene results in multiple phenotypic alterations in C. albicans, although it does not significantly affect fungal growth rate . Key phenotypic changes include:

  • Morphology: Sho1Δ/Δ mutants predominantly exhibit yeast or pseudomycelium states, while control strains mostly display mycelium forms

  • Colony appearance: Surface of Sho1Δ/Δ colonies appears smooth, whereas control colonies are rough

  • Biofilm formation: Significantly decreased biofilm formation capacity with sparse structure and reduced thickness

  • Adhesion ability: Markedly diminished adherence to surfaces

  • Flocculation ability: Reduced cell-to-cell adhesion and aggregation

To study these phenotypes, researchers should employ multiple complementary techniques, including growth curve analysis, microscopy (particularly scanning electron microscopy for biofilm structure), quantitative biofilm assays, and flocculation tests. Complete phenotypic characterization requires both in vitro and in vivo approaches to fully understand Sho1's functional significance .

How does Sho1 connect glycolysis to Ras1-cAMP signaling in C. albicans?

Sho1 serves as a critical link between glycolysis and Ras1-cAMP signaling in C. albicans through predicted physical interactions with key glycolytic enzymes . Based on interaction studies, Sho1 appears to interact with the glycolytic enzymes Pfk1, Fba1, Pgk1, and Cdc19, suggesting that it regulates Ras1-cAMP by establishing cellular energy levels produced by glycolysis .

The methodological approach to validate this connection involves both genetic and biochemical techniques. Researchers demonstrated that microcolony formation could be restored in Sho1-deficient cells by adding exogenous intermediates of glycolysis, specifically the downstream products of each predicted interacting enzyme: fructose 1,6-bisphosphate, glyceraldehyde phosphate, 3-phosphoglyceric acid, and pyruvate . This rescue experiment provides strong evidence for Sho1's role in connecting glycolytic metabolism to Ras1-cAMP signaling.

For researchers exploring this pathway, both transcriptomic analyses and metabolic profiling should be combined with protein-protein interaction studies to fully elucidate the mechanism by which Sho1 interfaces between these two critical cellular processes.

What is the impact of Sho1 on the expression of core microcolony genes?

Sho1 functions as a regulator of core microcolony genes that are essential for C. albicans virulence and adhesion . RT-qPCR analysis reveals that Sho1 deletion significantly reduces the expression of key genes including HWP1, ECE1, and PGA10, which are highly expressed during microcolony formation .

Experimental data shows that expression levels of these genes are reduced 0.3- to 0.01-fold in sho1Δ cells compared to wild-type cells, with expression restored to wild-type levels in complemented sho1Δ/SHO1 strains . Notably, the expression pattern in sho1Δ mutants closely resembles that observed in ras1Δ mutants, further supporting the functional connection between Sho1 and the Ras1-cAMP pathway .

For researchers investigating gene expression changes, a comprehensive transcriptomic approach (RNA-Seq) combined with targeted validation by RT-qPCR is recommended. Additionally, chromatin immunoprecipitation (ChIP) experiments would help determine whether the regulatory effects are direct or indirect.

How does Sho1 modulate the host immune response during C. albicans infection?

Sho1 significantly influences the host immune response during C. albicans infection by altering immune cell populations and inflammatory responses . In mouse models of systemic infection, deletion of the Sho1 gene results in distinct immunomodulatory effects:

  • Macrophage polarization: Decreased percentage of pro-inflammatory M1-type macrophages and increased anti-inflammatory M2-type macrophages, resulting in a reduced M1/M2 ratio

  • T-cell response: Increased number of Th1 cells with decreased Th2 and Th17 cells, leading to an elevated Th1/Th2 ratio

  • Tissue inflammation: Reduced inflammatory cell infiltration in the kidney

The methodological approach for studying these immune effects involves establishing a mouse model of systemic infection via tail vein injection, followed by flow cytometry analysis of immune cell populations in the spleen and histopathological examination of affected organs. For researchers investigating immune modulation, both in vivo and ex vivo approaches are necessary, including co-culture experiments with immune cells and C. albicans strains with various Sho1 expression levels.

What methods are most effective for generating Sho1 knockout strains in C. albicans?

For generating Sho1 knockout strains in C. albicans, homologous recombination has proven to be more reliable than CRISPR-Cas9 approaches . While CRISPR-Cas9 technology has been used to construct gene-knockout strains of C. albicans, this method can be challenging, complex, and prone to off-target effects .

The recommended methodology involves:

  • Using a defective strain (such as SN152) as the parent strain

  • Employing nutritional markers (HIS and LEU) as screening tools

  • Knocking out both alleles of C. albicans SHO1 (as C. albicans is diploid)

  • Confirming successful knockout through nutritional selection, PCR, and sequencing verification

For researchers conducting gene deletion experiments, it's essential to include proper controls, such as complemented strains (sho1Δ/SHO1), to confirm phenotypic changes are specifically due to Sho1 deletion rather than unintended genetic alterations .

What in vivo models are most appropriate for studying Sho1's role in pathogenicity?

Systemic infection models using mouse tail vein injections have proven effective for studying Sho1's role in C. albicans pathogenicity . This model allows for assessment of multiple parameters:

  • Survival studies: Mice injected with SHO1-deleted strains show significantly higher survival rates compared to control strain injections

  • Organ fungal load: Quantitative assessment of fungal burden in the liver, kidney, and spleen

  • Histopathological examination: Evaluation of tissue damage and inflammatory cell infiltration

  • Immunological analysis: Flow cytometry assessment of immune cell populations and polarization

When designing in vivo experiments, researchers should consider:

  • Appropriate sample sizes for statistical significance

  • Monitoring fungal burden at multiple time points

  • Complementary ex vivo experiments with infected tissues

  • Both histological and molecular analysis of infected organs

  • Ethical considerations and appropriate controls

How can the interaction between Sho1 and glycolytic enzymes be effectively studied?

The interaction between Sho1 and glycolytic enzymes (Pfk1, Fba1, Pgk1, and Cdc19) represents a critical area for understanding C. albicans metabolism and virulence . Effective methodological approaches include:

  • Co-immunoprecipitation (Co-IP) assays to confirm physical interactions

  • Proximity ligation assays to visualize protein interactions in situ

  • Yeast two-hybrid or split-ubiquitin assays for membrane protein interactions

  • Metabolic rescue experiments using glycolytic intermediates

  • Fluorescence resonance energy transfer (FRET) for real-time interaction analysis

When designing interaction studies, researchers should consider:

  • Using epitope-tagged proteins that maintain native function

  • Including appropriate negative controls to rule out non-specific interactions

  • Confirming interactions through multiple complementary techniques

  • Assessing the functional significance of interactions through genetic and biochemical approaches

  • Determining the domains involved in protein-protein interactions

How should researchers interpret contradictory findings regarding Sho1's role in different fungal species?

While Sho1 functions as an upstream regulator of the Ras1-cAMP pathway in C. albicans, it has different roles in other fungi, such as regulating the Cek1-MAP kinase pathway in some yeast species . This apparent contradiction requires careful interpretation.

Researchers should:

  • Acknowledge evolutionary divergence in signaling pathways between fungal species

  • Consider the possibility of context-dependent functions of Sho1

  • Examine whether Sho1 might simultaneously regulate multiple pathways with different relative importance in various species

  • Use genetic epistasis experiments to definitively establish pathway relationships

  • Consider the possibility that different experimental conditions might activate different Sho1-dependent pathways

When investigating signaling pathway dynamics, pathway-specific reporter assays, phosphorylation status of downstream effectors, and genetic epistasis experiments provide valuable insights into the actual signaling relationships in a specific fungal species.

What is the significance of Sho1 expression variability in clinical isolates?

The elevated expression of Sho1 in clinical isolates compared to laboratory strains suggests its importance in natural infection settings . Researchers should interpret this finding carefully by considering:

  • Whether increased Sho1 expression represents adaptation to the host environment

  • If higher expression correlates with increased virulence or specific virulence traits

  • Whether expression levels vary according to the infection site or patient factors

  • If expression changes during the course of infection or in response to antifungal treatment

From a methodological perspective, researchers investigating expression variability should:

  • Use multiple reference genes for RT-qPCR normalization

  • Consider allelic variations in Sho1 among clinical isolates

  • Correlate expression levels with measurable virulence traits

  • Use reporter constructs to investigate the regulation of Sho1 expression

  • Examine epigenetic factors that might influence expression levels

Can Sho1 serve as a potential target for antifungal drug development?

The involvement of Sho1 in critical virulence mechanisms makes it a promising target for antifungal drug development . Sho1 deletion significantly reduces C. albicans pathogenicity, suggesting that pharmacological inhibition might achieve similar effects .

For researchers exploring Sho1 as a drug target, consider:

  • Developing high-throughput screening assays for compounds that inhibit Sho1 function

  • Focusing on the membrane-localization domain or interaction interfaces with glycolytic enzymes

  • Testing candidate molecules in both in vitro virulence assays and in vivo infection models

  • Assessing potential off-target effects on human proteins

  • Evaluating resistance development potential through laboratory evolution experiments

A comprehensive drug development approach would include structural studies of Sho1 to identify potential binding pockets, combined with functional assays to identify compounds that disrupt Sho1's interactions with glycolytic enzymes or its role in cAMP signaling.

How might Sho1 manipulation affect the efficacy of existing antifungal treatments?

Given Sho1's role in biofilm formation and virulence, its manipulation could potentially enhance the efficacy of existing antifungals . Biofilms are notoriously resistant to antifungal treatment, and Sho1 deletion results in diminished biofilm formation .

Research approaches to investigate this question include:

  • Combination treatment studies using Sho1 inhibitors with established antifungals

  • Testing antifungal susceptibility of Sho1-deficient strains compared to wild-type

  • Evaluating biofilm penetration and efficacy of antifungals against Sho1-deleted strains

  • Investigating whether Sho1 deletion affects established resistance mechanisms

  • Determining if Sho1 inhibition could reduce the dosage requirements for toxic antifungals

For researchers investigating combination approaches, checkerboard assays to determine synergy, time-kill studies, and in vivo efficacy models would provide comprehensive insights into the potential benefits of targeting Sho1 alongside conventional antifungal therapy.

What are the critical knowledge gaps in understanding Sho1's role in C. albicans?

Despite significant advances, several knowledge gaps remain in our understanding of Sho1's function:

  • The precise molecular mechanism by which Sho1 connects to glycolytic enzymes

  • The structural domains of Sho1 responsible for its various functions

  • How environmental signals are integrated through Sho1 to modulate downstream pathways

  • The extent to which Sho1 function varies across different infection sites

  • Whether Sho1 plays a role in antifungal resistance development

Researchers should consider employing emerging technologies, including:

  • CRISPR interference for conditional gene regulation

  • Proximity-dependent biotinylation to identify the complete Sho1 interactome

  • Single-cell transcriptomics to understand heterogeneity in Sho1-dependent responses

  • Advanced imaging techniques to visualize Sho1 localization during infection

How might artificial intelligence and computational approaches advance Sho1 research?

Computational and AI approaches offer powerful tools for advancing Sho1 research:

  • Protein structure prediction using AlphaFold or similar tools to understand Sho1's structural features

  • Network analysis to position Sho1 within the broader context of C. albicans signaling

  • Virtual screening for potential Sho1 inhibitors

  • Systems biology approaches to model the impact of Sho1 on cellular metabolism

  • Comparative genomics to understand Sho1 evolution across fungal species

For researchers employing computational approaches, combining in silico predictions with experimental validation is essential. Structural predictions should guide mutagenesis experiments, while virtual screening hits must be validated through biochemical and cellular assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.