Recombinant Candida albicans Methylsterol monooxygenase (ERG25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG25; CAALFM_CR02370WA; CaO19.11216; CaO19.3732; Methylsterol monooxygenase; C-4 methylsterol oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Target Names
ERG25
Target Protein Sequence
MSSISNVYHDYSSFSNATTFSQVYQNFNQLDNLNVFEKLWGSYYYYMANDLFATGLLFFL THEIFYFGRCLPWAIIDRIPYFRKWKIQDEKIPSDKEQWECLKSVLTSHFLVEAFPIWFF HPLCQKIGISYQVPFPKITDMLIQWAVFFVLEDTWHYWFHRGLHYGVFYKYIHKQHHRYA APFGLAAEYAHPVEVALLGLGTVGIPIVWCLITGNLHLFTVSIWIILRLFQAVDAHSGYE FPWSLHNFLPFWAGADHHDEHHHYFIGGYSSSFRWWDFILDTEAGPKAKKGREDKVKQNV EKLQKKNL
Uniprot No.

Target Background

Function
Catalyzes the initial step in the removal of the two C-4 methyl groups from 4,4-dimethylzymosterol.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and function of Candida albicans ERG25?

Candida albicans ERG25 encodes C-4 sterol methyl oxidase, a key enzyme in the ergosterol biosynthesis pathway. The protein comprises 308 amino acids and shows 65% homology to Saccharomyces cerevisiae ERG25 and 38% homology to the human version. Structurally, ERG25 contains three histidine clusters common to nonheme iron-binding enzymes and possesses an endoplasmic reticulum retrieval signal. The enzyme functions as a methyl oxidase that catalyzes the conversion of dimethylzymosterol to zymosterol, a critical precursor for ergosterol, which is essential for fungal cell membrane integrity .

How does ERG25 differ from its paralog ERG251?

While ERG25 and ERG251 show significant sequence divergence, they can partially compensate for each other during ergosterol biosynthesis. ERG251 is expressed at higher levels than ERG25 in wild-type cells, making it the major player in methyl sterol synthesis. When ERG251 is deleted, ERG25 expression increases to compensate, although the increased abundance of ERG25 transcripts remains lower than normal ERG251 transcript levels. This paralog compensation highlights the redundancy in the ergosterol biosynthesis pathway, although attempts to generate a double homozygous deletion of both genes were unsuccessful, suggesting their combined function is essential for viability .

What methods are used to clone and express recombinant C. albicans ERG25?

The ERG25 gene can be cloned by complementing a Saccharomyces cerevisiae erg25 mutant with a C. albicans genomic library. After identification, the gene can be amplified by PCR using specific primers designed from the C. albicans genome sequence. For recombinant expression, the ERG25 gene is typically cloned into expression vectors with suitable promoters and tags for purification. Expression can be performed in heterologous hosts such as E. coli, S. cerevisiae, or Pichia pastoris, with the latter two being preferred due to their ability to perform post-translational modifications. Purification typically involves affinity chromatography using histidine or GST tags followed by size exclusion chromatography .

How do mutations in ERG25 affect azole susceptibility in C. albicans?

Mutations in ERG25 and its paralog ERG251 can significantly alter azole susceptibility in C. albicans. Heterozygous inactivation of ERG251 results in azole tolerance, while homozygous deletion leads to increased fitness in the presence of low concentrations of fluconazole (FLC). In the presence of FLC, ERG251 deletion mutants exhibit upregulation of ZRT2 (a zinc finger transporter) and genes in the alternate sterol biosynthesis pathway. The homozygous deletion of ERG251 leads to upregulation of alternative sterols that promote survival in the presence of FLC, including an 8-fold increase in ERG6 expression compared to wild-type cells when exposed to FLC. The heterozygous mutants demonstrate azole tolerance through mechanisms independent of changes in ergosterol biosynthesis gene expression .

What is the relationship between ERG25 and the ERAD pathway?

ERG25 is a resident enzyme of the endoplasmic reticulum (ER) and has been identified as a substrate of the ER-associated degradation (ERAD) pathway. Biochemical and genetic analyses have confirmed that ERG25 associates with the proteasome, is polyubiquitinated, and its degradation depends on ERAD-associated E3 ligases. This regulatory mechanism is influenced by sterol synthesis, establishing ERG25 as a bona fide ERAD substrate. This finding expands our understanding of regulated wild-type enzymes directed to the ERAD pathway and highlights the ER's role as a dynamic regulator of both protein synthesis and degradation .

How does conditional inactivation of ERG25 affect C. albicans viability?

Temperature-sensitive (ts) conditional lethal mutations of C. albicans ERG25 have been generated and studied. Sequence analysis of ts mutants revealed amino acid substitutions within the histidine cluster regions involved in iron binding. These conditional mutants demonstrate that ERG25 is essential for viability in C. albicans, as complete loss of function is lethal. Plasmid-borne conditional lethal mutants of ERG25 have potential applications in rescuing Candida mutations in genes essential for viability, providing a valuable tool for studying gene function and identifying potential antifungal targets .

What are the optimal conditions for expressing and purifying recombinant ERG25?

Table 1: Optimal conditions for recombinant ERG25 expression and purification

ParameterRecommended ConditionsNotes
Expression SystemPichia pastorisProvides proper folding and post-translational modifications
VectorpPICZα with C-terminal His6 tagAllows secretion and easy purification
Induction0.5% methanol for 72-96h at 25°CLower temperatures improve folding
Cell LysisMechanical disruption with glass beadsPreserves enzyme activity
Buffer50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerolMaintains stability
PurificationNi-NTA affinity chromatography followed by gel filtrationTwo-step purification increases purity
Storage-80°C in 20% glycerolMaintains activity for several months

For optimal expression of recombinant ERG25, the gene should be codon-optimized for the host organism and cloned into an expression vector with a strong inducible promoter. The protein should be expressed with an affinity tag (His6 or GST) to facilitate purification. Since ERG25 is a membrane-associated protein, detergents such as n-dodecyl-β-D-maltoside (DDM) should be included in the purification buffers to maintain solubility. Addition of protease inhibitors during purification is crucial to prevent degradation .

What assays can be used to measure ERG25 enzymatic activity?

ERG25 activity can be measured using several approaches:

  • LC-MS/MS Analysis: This method quantifies the conversion of dimethylzymosterol to zymosterol. The reaction mixture contains purified ERG25, substrate, NADPH, and ferredoxin/ferredoxin reductase as electron donors. After incubation, sterols are extracted with organic solvents and analyzed by LC-MS/MS.

  • Radiometric Assay: Using 14C-labeled substrates, the conversion of labeled dimethylzymosterol to zymosterol can be tracked. Products are separated by thin-layer chromatography and quantified by autoradiography.

  • Complementation Assay: ERG25 activity can be assessed by its ability to complement S. cerevisiae erg25 mutants. Growth restoration indicates functional activity.

  • Oxygen Consumption Assay: Since ERG25 catalyzes an oxidation reaction, oxygen consumption can be measured using an oxygen electrode, providing a real-time assay for activity .

How can researchers generate and validate ERG25 knockout or conditional mutants?

Generating ERG25 mutants requires careful strategy as complete deletion is likely lethal. Methods include:

  • CRISPR-Cas9 System: For generating precise mutations or targeted deletions. Two guide RNAs targeting the gene with a repair template containing the desired mutation can be used.

  • Conditional Expression: Using tetracycline-repressible promoters to control ERG25 expression, allowing for inducible knockdown.

  • Temperature-sensitive Mutants: Creating temperature-sensitive alleles by random mutagenesis and selection at restrictive temperatures.

  • Heterozygous Knockouts: Deleting one allele in the diploid C. albicans to study haploinsufficiency effects.

Validation should include:

  • PCR confirmation of gene modifications

  • RNA sequencing to confirm expression changes

  • Sterol profiling using GC-MS or LC-MS to detect altered sterol composition

  • Complementation tests to verify that phenotypes result from the intended modification

  • Growth assays under various conditions to characterize the phenotype .

How does ERG25 contribute to azole resistance mechanisms?

ERG25 plays a complex role in azole resistance through multiple mechanisms:

  • Alternate Sterol Biosynthesis: When ERG25 or its paralog ERG251 is partially inactivated, there is upregulation of alternate sterol biosynthesis pathways, allowing cells to survive despite azole inhibition of ERG11.

  • ZRT2 Upregulation: ERG25/ERG251 mutants show increased expression of ZRT2, a zinc finger transporter, which contributes to azole tolerance.

  • Membrane Composition Changes: Alterations in ERG25 function change the sterol composition of the cell membrane, potentially reducing the ability of azoles to disrupt membrane integrity.

  • Synergy with Aneuploidy: Single allele dysfunction of ERG251 in combination with aneuploidy of chromosomes 3 and 6 leads to complete azole resistance rather than just tolerance.

  • Stress Response Modulation: ERG25 mutations affect cellular stress responses, including cell wall organization and oxidative stress response, which can contribute to drug tolerance .

What is the interaction between ERG25 and other ergosterol biosynthesis enzymes during azole exposure?

During azole exposure, the relationship between ERG25 and other ergosterol biosynthesis enzymes undergoes significant changes:

  • Compensatory Upregulation: Almost all ERG genes show increased expression in response to fluconazole exposure, regardless of ERG25/ERG251 status.

  • ERG6 Overexpression: In ERG251 homozygous deletion mutants, ERG6 shows dramatic 8-fold increased expression in the presence of fluconazole compared to wild-type cells, suggesting a compensatory mechanism.

  • Pathway Rerouting: When azoles inhibit ERG11, cells attempt to maintain membrane integrity by modifying the expression of other ergosterol pathway enzymes, including ERG25.

  • ERG25-ERG251 Compensation: ERG25 expression increases when ERG251 is deleted, demonstrating paralog compensation within the pathway.

The network of interactions suggests that the ergosterol biosynthesis pathway has significant plasticity, allowing for adaptation to drug pressure through coordinated regulation of multiple enzymes .

How can ERG25 be targeted for novel antifungal development?

Table 2: Strategies for targeting ERG25 in antifungal development

ApproachMechanismPotential AdvantagesChallenges
Direct InhibitionSmall molecule inhibitors of ERG25 enzymatic activityNovel target with potential for fungal selectivityDesigning inhibitors that don't affect human homologs
DestabilizationCompounds that promote ERG25 degradation via ERADMay overcome resistance mechanismsComplex mechanism requiring thorough understanding of ERAD
Combination TherapyERG25 inhibitors with azoles or other antifungalsSynergistic effects, reduced resistance developmentPotential for complex drug interactions
Allosteric ModulatorsCompounds targeting regulatory sites rather than active siteMay offer greater selectivityIdentifying suitable allosteric sites
Iron ChelationDisruption of iron binding to the histidine clustersAffects enzyme function without directly competing with substratePotential off-target effects on other iron-containing proteins

ERG25 represents a promising target for novel antifungal development due to its essential role in ergosterol biosynthesis and its differences from human homologs. Structure-based drug design focusing on the three histidine clusters involved in iron binding could yield selective inhibitors. Additionally, compounds that promote ERG25 degradation via the ERAD pathway might provide an alternative approach to inhibition. The temperature-sensitive mutants of ERG25 could serve as valuable tools for screening potential inhibitors under permissive and non-permissive conditions .

How do ERG25 mutations affect C. albicans virulence and host interactions?

ERG25 and its paralog ERG251 significantly impact C. albicans virulence through multiple mechanisms:

  • Filamentation Defects: Deletion of the A allele of ERG251 results in filamentation defects, which directly affects virulence since hyphal formation is a critical virulence factor in C. albicans.

  • Cell Wall Composition: Homozygous deletion of ERG251 leads to downregulation of 20 out of 26 genes encoding GPI-anchored motifs, which are crucial for cell wall integrity, cell-cell interaction, and hyphal formation.

  • Virulence Attenuation: Complete deletion of ERG251 (erg251Δ/Δ) shows decreased virulence in infection models, while heterozygous deletion mutants maintain pathogenicity, highlighting the gene's importance in virulence.

  • Stress Response Alterations: ERG251 deletion affects responses to osmotic stress (1.2M NaCl), cell membrane stress (0.03% SDS), and oxidative stress (H2O2), all of which are conditions encountered during host infection.

  • Biofilm Formation: Transcriptional analysis reveals that ERG251 affects genes associated with biofilm formation, which is a key virulence determinant allowing C. albicans to resist antifungal treatment and host immune responses .

What techniques can resolve contradictory data on ERG25 function in different C. albicans strains?

When facing contradictory data on ERG25 function across different C. albicans strains, researchers should employ these methodological approaches:

  • Genome Sequencing: Whole-genome sequencing of different strains to identify genetic variations beyond the ERG25 locus that might influence phenotypes.

  • Genetic Background Normalization: Creating mutations in multiple well-characterized genetic backgrounds to distinguish strain-specific effects from general ERG25 functions.

  • Allele Swapping: Transferring specific alleles between strains to determine if phenotypic differences are linked to allelic variations.

  • Transcriptional Profiling: Conducting RNA-seq analysis across strains to identify differences in gene expression patterns that might explain phenotypic variations.

  • Metabolomic Analysis: Comprehensive sterol profiling using mass spectrometry to correlate sterol composition with functional differences.

  • Epistasis Analysis: Systematically combining ERG25 mutations with mutations in other pathway components to map strain-specific genetic interactions.

  • Standardized Phenotyping: Employing consistent, quantitative assays for drug susceptibility, growth, stress response, and virulence across all strains .

How do post-translational modifications regulate ERG25 function?

ERG25 function is regulated by several post-translational modifications and protein interactions:

  • Ubiquitination: ERG25 is polyubiquitinated as part of its regulation by the ERAD pathway, which controls enzyme levels in response to cellular sterol content.

  • Protein-Protein Interactions: As an ER-resident protein, ERG25 likely interacts with other components of the ergosterol biosynthesis pathway, forming a functional complex.

  • Iron Coordination: The three histidine clusters in ERG25 coordinate iron, which is essential for catalytic activity. Changes in cellular iron availability may affect enzyme function.

  • Membrane Association: ERG25's association with the ER membrane is critical for its function and is likely regulated by specific membrane-targeting signals.

  • Sterol-Dependent Regulation: The degradation of ERG25 via the ERAD pathway is regulated by sterol synthesis, suggesting a feedback mechanism where the enzyme's stability is influenced by the pathway's products.

Understanding these regulatory mechanisms provides insights into how cells fine-tune ergosterol biosynthesis in response to environmental conditions and drug challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.